Rhodobacter xanthinilyticus: LPB142_11935 Help Entry LPB142_11935      CDS       T04631                                  Name (GenBank) cyd operon protein YbgT   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism rhp  Rhodobacter xanthinilyticus Pathway rhp00190   Oxidative phosphorylation rhp01100   Metabolic pathways rhp02020   Two-component system Module rhp_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:rhp00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     LPB142_11935  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     LPB142_11935 Enzymes [BR:rhp01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      LPB142_11935 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB Motif Other DBs NCBI-ProteinID:  AOZ69947 UniProt:  A0A1D9MDK6 LinkDB All DBs Position 2448044..2448166 Genome browser AA seq 40 aa AA seqDB search MWYFAWILGLPLAALIAVVNAMWLEMQEDRRLAGDHDPEP NT seq 123 nt NT seq  +upstreamnt  +downstreamnt atgtggtattttgcctggatcctggggctcccgctcgccgcgctgatcgcggtggtgaat gcgatgtggctcgagatgcaagaggatcgccgcctcgccggcgatcacgaccccgagccc tga

DBGET integrated database retrieval system