KEGG   Rhizobium sp. 11515TR: CKA34_15635
Entry
CKA34_15635       CDS       T06097                                 
Symbol
petA
Name
(GenBank) ubiquinol-cytochrome c reductase iron-sulfur subunit
  KO
K00411  ubiquinol-cytochrome c reductase iron-sulfur subunit [EC:7.1.1.8]
Organism
rhr  Rhizobium sp. 11515TR
Pathway
rhr00190  Oxidative phosphorylation
rhr01100  Metabolic pathways
rhr02020  Two-component system
rhr04148  Efferocytosis
Module
rhr_M00151  Cytochrome bc1 complex respiratory unit
Brite
KEGG Orthology (KO) [BR:rhr00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CKA34_15635 (petA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CKA34_15635 (petA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04148 Efferocytosis
    CKA34_15635 (petA)
Enzymes [BR:rhr01000]
 7. Translocases
  7.1  Catalysing the translocation of protons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.8  quinol---cytochrome-c reductase
     CKA34_15635 (petA)
SSDB
Motif
Pfam: UCR_Fe-S_N Rieske
Other DBs
NCBI-ProteinID: ASW07187
LinkDB
Position
complement(3171782..3172360)
AA seq 192 aa
MSEHSTTSESTGEPTRRDFLYLTTGMAGAVGAVSVAWPFIDQMRPDASTLALASIEVDVS
SLEPGMSLTVKWRGKPVFIRNRTQKEIDDAKGTQLSDLKDPIARNANLPSDAQATDVARS
AGEGKENWLVMIGVCTHLGCIPLGQAGEYGGWFCPCHGSVYDTAGRIRHGPAPQNLFIPQ
YAFTSEKKIKVG
NT seq 579 nt   +upstreamnt  +downstreamnt
ttgagcgagcatagtacgacaagtgaatccacaggcgagcctacgcgccgcgatttcctt
tatttgacgacaggcatggctggcgccgttggtgcggtttcggtcgcatggccgtttatc
gaccagatgcgcccggatgcatcgacgcttgctcttgcttccatcgaggtcgacgtgtcc
agccttgagcccggcatgtcgttgacggtgaagtggcgtggcaaacccgtcttcatccgt
aaccgcacgcagaaagaaatcgacgatgccaagggcacacagctttcggacctgaaggat
ccgatcgctcgcaacgccaatcttccgtccgatgcacaggcaaccgacgttgcccgttcg
gccggcgaaggcaaggaaaactggctcgtcatgatcggcgtctgcacccatctgggttgc
attccgctcggccaggcaggtgaatatggcgggtggttctgtccctgccatggttcggtc
tacgataccgccggtcgcatccgccatgggcctgcgccgcagaacctcttcatcccgcaa
tatgcgtttacgtcggaaaagaagatcaaggtcggttga

DBGET integrated database retrieval system