Rhizobium sp. 11515TR: CKA34_15635
Help
Entry
CKA34_15635 CDS
T06097
Symbol
petA
Name
(GenBank) ubiquinol-cytochrome c reductase iron-sulfur subunit
KO
K00411
ubiquinol-cytochrome c reductase iron-sulfur subunit [EC:
7.1.1.8
]
Organism
rhr
Rhizobium sp. 11515TR
Pathway
rhr00190
Oxidative phosphorylation
rhr01100
Metabolic pathways
rhr02020
Two-component system
rhr04148
Efferocytosis
Module
rhr_M00151
Cytochrome bc1 complex respiratory unit
Brite
KEGG Orthology (KO) [BR:
rhr00001
]
09100 Metabolism
09102 Energy metabolism
00190 Oxidative phosphorylation
CKA34_15635 (petA)
09130 Environmental Information Processing
09132 Signal transduction
02020 Two-component system
CKA34_15635 (petA)
09140 Cellular Processes
09141 Transport and catabolism
04148 Efferocytosis
CKA34_15635 (petA)
Enzymes [BR:
rhr01000
]
7. Translocases
7.1 Catalysing the translocation of protons
7.1.1 Linked to oxidoreductase reactions
7.1.1.8 quinol---cytochrome-c reductase
CKA34_15635 (petA)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
UCR_Fe-S_N
Rieske
Motif
Other DBs
NCBI-ProteinID:
ASW07187
LinkDB
All DBs
Position
complement(3171782..3172360)
Genome browser
AA seq
192 aa
AA seq
DB search
MSEHSTTSESTGEPTRRDFLYLTTGMAGAVGAVSVAWPFIDQMRPDASTLALASIEVDVS
SLEPGMSLTVKWRGKPVFIRNRTQKEIDDAKGTQLSDLKDPIARNANLPSDAQATDVARS
AGEGKENWLVMIGVCTHLGCIPLGQAGEYGGWFCPCHGSVYDTAGRIRHGPAPQNLFIPQ
YAFTSEKKIKVG
NT seq
579 nt
NT seq
+upstream
nt +downstream
nt
ttgagcgagcatagtacgacaagtgaatccacaggcgagcctacgcgccgcgatttcctt
tatttgacgacaggcatggctggcgccgttggtgcggtttcggtcgcatggccgtttatc
gaccagatgcgcccggatgcatcgacgcttgctcttgcttccatcgaggtcgacgtgtcc
agccttgagcccggcatgtcgttgacggtgaagtggcgtggcaaacccgtcttcatccgt
aaccgcacgcagaaagaaatcgacgatgccaagggcacacagctttcggacctgaaggat
ccgatcgctcgcaacgccaatcttccgtccgatgcacaggcaaccgacgttgcccgttcg
gccggcgaaggcaaggaaaactggctcgtcatgatcggcgtctgcacccatctgggttgc
attccgctcggccaggcaggtgaatatggcgggtggttctgtccctgccatggttcggtc
tacgataccgccggtcgcatccgccatgggcctgcgccgcagaacctcttcatcccgcaa
tatgcgtttacgtcggaaaagaagatcaaggtcggttga
DBGET
integrated database retrieval system