KEGG   Rhodococcus sp. PBTS 2: A3Q41_04765
Entry
A3Q41_04765       CDS       T05030                                 

Gene name
aam_3
Definition
(GenBank) Acylamidase
  KO
K19795  ureidomalonase [EC:3.5.1.95]
Organism
rhs  Rhodococcus sp. PBTS 2
Pathway
rhs00240  Pyrimidine metabolism
rhs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rhs00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    A3Q41_04765 (aam_3)
Enzymes [BR:rhs01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.95  N-malonylurea hydrolase
     A3Q41_04765 (aam_3)
SSDB
Motif
Pfam: Amidase
Other DBs
NCBI-ProteinID: AMY26029
UniProt: A0A143QSV2
LinkDB
Position
5020659..5022107
AA seq 482 aa
MATTVGPAAELLMSDAVELSGKIKRREVSCVETMTAYLDHIEAHNPTVNAIVALRDRDEL
LAEARERDRQLSDGQYLGWMHGFPHAVKDLSAARGLPFTSGSPIFADRIAEADDLFVARV
KAAGAIVIGKTNTPEFGFGSQTYNPVYGTTVSPYDTSRTAGGSSGGAAAALALRMLPVAD
GTDYMGSLRNPAAFNNVVGFRPSWGRIPEPGFIAQGAVAGPMGRSVTDVAHLLSTMAGPD
ANAPLGIDEDPEIFTRTLERSFRGARIAWVGDWNGHLATEPGVLDLCESSFTVFEDLGCA
VESTVPSYDPAKIWDSFLTWRWWAQLGMADLYENPRTRELMKPEMLWEMEHAVALTALDV
TKAAQARNDWQSALTTLFETYDFVLAPTAQVFPFDKDQHWPQSIAGRPMDTYHRWMETVV
PWTMTGVPAAAVPVGFDDRGLPMGVQIIGRHGADRAVLQLAYAYEQASRWVERVLPPALH
VG
NT seq 1449 nt   +upstreamnt  +downstreamnt
atggcaaccaccgtcggacccgctgccgaacttctgatgtccgacgcggtcgagctcagc
ggcaagatcaagcgccgcgaggtctcgtgcgtcgagaccatgacggcgtacctcgaccac
atcgaggcacacaatccgacggtcaatgccattgtcgccctgcgtgatcgcgacgagctg
ctggccgaggcacgcgagcgggatcggcagctctcggacgggcagtatctcgggtggatg
cacggatttccccatgcggtgaaggatctgtcggcagcccgagggctaccgttcacatcg
gggtcaccgatcttcgccgatcgcatcgccgaggcggacgatctgttcgtcgcccgcgtg
aaagcggccggtgccatcgtgatcggcaagaccaacacaccggaattcgggttcggatct
cagacgtacaacccggtgtacggaaccaccgtctcgccctacgacacctcgcgcactgca
ggcggaagcagcggaggtgcggcggcagccttggcactacgcatgctgcccgtcgccgac
ggcaccgactacatgggatcgctgcgcaaccccgcagccttcaacaatgtggtcggtttt
cgcccgtcgtggggacgcattcccgagccgggcttcatcgcacagggcgctgtcgccgga
ccgatgggccgatcggtcaccgatgtcgcacatctgctgtcgacgatggcgggcccggat
gccaacgcgcccctcggaatcgacgaggatccggagatcttcacccgcactctcgaacgt
agcttccgcggtgcccgcatcgcgtgggtcggagactggaacggtcacctggctaccgaa
cccggtgtcctcgatctgtgcgagtcgtcgttcaccgtcttcgaggacctcggctgcgca
gtggagagcaccgtgccgtcgtacgacccggcaaaaatctgggactcgttcctgacgtgg
cggtggtgggcgcagctcgggatggccgatctgtacgagaacccgcgcacgagggagctg
atgaagcccgaaatgctgtgggagatggagcatgccgtcgcattgaccgcactcgatgtc
accaaggcagcgcaggctcgcaacgactggcagagcgcactgacgacattgttcgagacc
tacgacttcgttctcgcgcccaccgctcaggtgttcccgttcgacaaggaccaacactgg
ccgcagtccatcgcgggtcgacccatggacacctatcaccggtggatggaaacggtggtg
ccctggacgatgaccggcgttcctgccgccgccgtcccggtcggattcgacgatcggggt
ctgccgatgggtgttcagatcatcggcaggcacggtgccgaccgcgcggttctgcagctc
gcctacgcctacgagcaggcctcgcggtgggtcgagcgcgtcctcccgccggcactgcac
gtcggctga

DBGET integrated database retrieval system