Rhodococcus sp. WMMA185: BFN03_04785 Help Entry BFN03_04785       CDS       T04814                                  Name (GenBank) glutaredoxin-like protein   KO K18917   mycoredoxin [EC:1.20.4.3] Organism rhw  Rhodococcus sp. WMMA185 Brite KEGG Orthology (KO) [BR:rhw00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     BFN03_04785 Enzymes [BR:rhw01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      BFN03_04785 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin Thioredoxin_2 Glrx-like GST_N_2 Thioredoxin GST_N_3 Motif Other DBs NCBI-ProteinID:  AOW92258 UniProt:  A0A1D8T3H7 LinkDB All DBs Position complement(1076832..1077134) Genome browser AA seq 100 aa AA seqDB search MPRDGNTLRFHGVISAVTATDTPDLTIYSTTWCGYCRRLKTQLDESGISYVEIDIEDDPA SADFVGSVNGGNHVVPTVKFADGSTATNPSLAQVKKLLGV NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atgccacgcgatgggaacacattacgttttcatggtgttattagcgccgtgactgcgacc gatacccctgacctgaccatctactccacaacgtggtgcggctactgccggcgtctgaag acgcaactggacgagtccggcatcagctacgtggagatcgacatagaagacgatccggcg tccgctgatttcgttggcagcgtcaacggcggaaaccatgtcgtcccgacagtcaagttc gccgatggcagcaccgcgaccaatccttcgctcgcccaggtcaaaaaactgctcggcgtc tag

DBGET integrated database retrieval system