Rhodococcus sp. WAY2: GFS60_07755 Help Entry GFS60_07755       CDS       T11412                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism rhwy  Rhodococcus sp. WAY2 Pathway rhwy01100   Metabolic pathways rhwy01110   Biosynthesis of secondary metabolites Module rhwy_M00885   Meromycolic acid biosynthesis, initiation and elongation FAS II (KasA) Brite KEGG Orthology (KO) [BR:rhwy00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     GFS60_07755    00074 Mycolic acid biosynthesis     GFS60_07755   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     GFS60_07755 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-ProteinID:  QHE74067 LinkDB All DBs Position pRWAY02:403698..403919 Genome browser AA seq 73 aa AA seqDB search MAAMPGTFVAGLGRIIELLTGIEPSEIGLDKTFAGDFGMAPRSVAEIAGQVGDKRSVRIT DEGLAGRHTIRTP NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atggccgcaatgcccggcacgttcgtcgcagggctcggacgaatcatcgaattactcacc gggatcgaaccctcggaaatcggcctcgacaagactttcgccggtgacttcggcatggct ccgcgttccgtcgcggaaatcgccggacaggtcggggacaagcgcagtgtccggattacc gacgaggggctcgctggtcgacacacgatccggacaccatga

DBGET integrated database retrieval system