Rhizobium sp. N731: AMK02_CH00681
Help
Entry
AMK02_CH00681 CDS
T04809
Symbol
cheB-1
Name
(GenBank) methyl-accepting chemotaxis protein methylesterase 1
KO
K03412
two-component system, chemotaxis family, protein-glutamate methylesterase/glutaminase [EC:
3.1.1.61
3.5.1.44
]
Organism
rhx
Rhizobium sp. N731
Pathway
rhx02020
Two-component system
rhx02030
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:
rhx00001
]
09130 Environmental Information Processing
09132 Signal transduction
02020 Two-component system
AMK02_CH00681 (cheB-1)
09140 Cellular Processes
09142 Cell motility
02030 Bacterial chemotaxis
AMK02_CH00681 (cheB-1)
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02022 Two-component system [BR:
rhx02022
]
AMK02_CH00681 (cheB-1)
02035 Bacterial motility proteins [BR:
rhx02035
]
AMK02_CH00681 (cheB-1)
Enzymes [BR:
rhx01000
]
3. Hydrolases
3.1 Acting on ester bonds
3.1.1 Carboxylic-ester hydrolases
3.1.1.61 protein-glutamate methylesterase
AMK02_CH00681 (cheB-1)
3.5 Acting on carbon-nitrogen bonds, other than peptide bonds
3.5.1 In linear amides
3.5.1.44 protein-glutamine glutaminase
AMK02_CH00681 (cheB-1)
Two-component system [BR:
rhx02022
]
CheA family
CheA-CheYBV (chemotaxis)
AMK02_CH00681 (cheB-1)
Bacterial motility proteins [BR:
rhx02035
]
Flagellar system
Chemotaxis proteins
Two component system proteins
AMK02_CH00681 (cheB-1)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
CheB_methylest
Response_reg
Motif
Other DBs
NCBI-ProteinID:
ANK84321
LinkDB
All DBs
Position
681830..682873
Genome browser
AA seq
347 aa
AA seq
DB search
MSAPARVLVVDDSPTMRGLITAVLSSDPEVSVIGQAGDALEAREAIKRLNPDVVTLDIEM
PNMNGLDFLEKIMTLRPMPVIMVSTMTHRGAEATLAALEIGAFDCVGKPGPGEPRPFGDL
AEKVKAAARTQRQFSQPAAAVTPPPSVADFRVGRKIVAIGSSTGGVEALIAVLQKFPANC
PPTVITQHMPPTFTKSFAERLNRLCAPVVQEATDGARLEIGKIYLAPGGERHLQVSGGSA
PCCRLVDRAPVNGHRPSVDVLFDSVAELAGRNAVGVILTGMGRDGAAGLLKMRHAGARTL
GQNEKTCVVYGMPRVAHELGAVEQQLPLTAIGEEILKLTAARKEGTE
NT seq
1044 nt
NT seq
+upstream
nt +downstream
nt
atgagcgctccggcaagagttctcgttgttgacgactcgccgaccatgcggggtctgatt
accgcagtgctgagctccgacccggaagtcagcgtcatcggccaggccggcgatgcactg
gaagcgcgcgaggcgatcaagcggctgaatccggacgtcgtgacgctcgacatcgagatg
ccgaatatgaacggcctcgatttccttgaaaagatcatgacgctgcggccgatgccggtg
atcatggtgtcgacgatgacgcatcgcggcgccgaagcgacgcttgcggcgcttgagatc
ggcgccttcgattgcgtcggcaagcccggtcccggcgaacccaggccgttcggcgatctc
gccgagaaggtcaaggcggccgcgcgcacgcagcgtcagttctcccaaccggccgccgct
gtcacgcccccgccctccgtcgccgatttccgcgtcggccgcaagatcgtcgcgatcggc
tcgtcgaccggcggcgtcgaagcgctgatcgccgtgctgcagaaattcccggcaaattgc
ccgccgaccgtcatcactcagcatatgccgccgaccttcaccaagagtttcgccgaacgg
ctgaaccgtctctgcgcgccggtggtgcaggaagcgaccgatggcgcccgtctcgagatc
ggcaagatctacctggcgccgggcggcgaacgtcatctccaggtcagcggcggctccgcg
ccgtgctgccgtctcgtcgaccgggcgccggtcaacggtcaccgcccgtccgtggacgtg
ctctttgattcggtcgcggaactcgcaggccgcaacgccgtcggcgtgattctgaccgga
atgggccgcgatggcgccgccggattgttgaaaatgcgccacgcgggcgccagaacactc
ggccagaacgaaaaaacctgcgtcgtttacggaatgccaagggttgctcacgaacttggc
gccgtcgagcagcagctgccactgactgccatcggtgaagaaatattgaaattgacagcc
gcccgaaaggaagggaccgaataa
DBGET
integrated database retrieval system