Rhodoferax koreensis: RD110_08350 Help Entry RD110_08350       CDS       T04721                                  Name (GenBank) glutaredoxin 3   KO K03676   glutaredoxin 3 Organism rhy  Rhodoferax koreensis Brite KEGG Orthology (KO) [BR:rhy00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:rhy03110]     RD110_08350 Chaperones and folding catalysts [BR:rhy03110]  Protein folding catalysts   Protein disulfide isomerase    RD110_08350 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 GST_N_2 Glrx-like Thioredoxin_2 Redoxin DSBA TXD17-like_Trx Motif Other DBs NCBI-ProteinID:  APW37209 UniProt:  A0A1P8JTX0 LinkDB All DBs Position 1766752..1767012 Genome browser AA seq 86 aa AA seqDB search MQAVKMYTTAFCPYCVRAKQVLKSKGVDQIDEVRVDEQPQERMKMMELTGRRTVPQIFIG DTHVGGCDDLIALDGRGDLMPLLNAA NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgcaagccgtgaagatgtacaccaccgccttctgcccctactgcgtgcgcgccaagcag gtgctcaagagcaagggggtggaccagatcgacgaggtgcgcgtcgatgagcagccccag gagcgcatgaagatgatggagctgaccggccggcgcaccgtgccgcagattttcatcggc gacacccatgtcggcggctgcgacgatctgatcgcgctcgacggccgcggtgacctaatg ccgctgctgaacgccgcctga

DBGET integrated database retrieval system