Rugositalea oryzae: RHPLAN_20620
Help
Entry
RHPLAN_20620 CDS
T04290
Name
(GenBank) GntR family transcriptional regulator
Organism
rhz
Rugositalea oryzae
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
FCD
GntR
Rrf2
HTH_41
HTH_11
HTH_Crp_2
MarR
HTH_29
HrcA_DNA-bdg
FadR_C
HTH_24
MarR_2
TrmB
TFIIE_alpha
HTH_28
HTH_DeoR
HTH_36
HTH_5
Fe_dep_repress
PH0730-like_N
Motif
Other DBs
NCBI-ProteinID:
AMN40502
LinkDB
All DBs
Position
complement(2366318..2367091)
Genome browser
AA seq
257 aa
AA seq
DB search
MQEFPGIVTAGLAKQIAESLREQILSGKIKVAERLPTEEELARKFSVSRPTIREALKRLA
AENLIHSRRGPRGGSTVKHPRPEEASLSLSNALRLLAGLGEFDHAHIFEARCELESTCCR
LAAKRRNKDYLARMRTELETQRDATLTDEEFCASDVRFHRGLFEATENPILQFMLCAISD
ALQPVTNLVVFRFRDRKVICEQHQRLIEALEVSDAAGAVEVLQKQAQYLAHSYRKARAYR
KSRERKRGKDAKASAAR
NT seq
774 nt
NT seq
+upstream
nt +downstream
nt
gtgcaagaattccctggcatcgtaacggcggggctggcgaagcagatcgccgaaagcctg
cgcgagcagattctcagcgggaaaatcaaggtcgccgagcgcttgccgaccgaagaagag
cttgcgcgaaagttcagcgtatcccggccgacgatccgcgaggcgctgaagcggctggct
gccgagaacctcatccattcgcggcgcgggccacgcggcggctcgaccgtcaagcatccg
cgccccgaagaggcgtcattatcgttgagcaatgcgctccgcctgctggcgggactcggc
gagtttgatcacgcacatattttcgaagcccgctgcgaactggaaagcacatgctgcagg
ctcgcggccaagcgacgcaacaaggactatctcgccaggatgcggaccgagctcgagact
caacgcgatgcaacgctgaccgacgaggagttttgcgcgtccgacgtgaggtttcaccgg
ggcctgttcgaggccacggaaaaccccatcctgcaattcatgctttgcgcaatcagcgat
gcgttgcagccggtcaccaacctggtggtgttccggttccgcgatcgcaaggtcatctgc
gagcagcaccagcgattgatcgaagcgcttgaagtgtccgatgctgcaggtgcagtcgaa
gtcctgcagaagcaggcccaatatctggcgcacagctatcgcaaggctcgtgcgtatcgg
aaatcccgtgaacgcaagcgaggcaaagatgccaaggcctccgcggcacgatag
DBGET
integrated database retrieval system