Rathayibacter iranicus: C7V51_14150 Help Entry C7V51_14150       CDS       T05878                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ria  Rathayibacter iranicus Pathway ria01100   Metabolic pathways ria01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ria00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     C7V51_14150    00074 Mycolic acid biosynthesis     C7V51_14150   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     C7V51_14150 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  AZZ56888 UniProt:  A0AAD1AEW0 LinkDB All DBs Position 3007552..3007782 Genome browser AA seq 76 aa AA seqDB search MTDVLLALKRIISTYSDLPSERVGEASTLAELDVDSIFAVELILEIEQLFGVRLSLDEIV ADETLGMLADRIINHS NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgaccgatgtgctactagctctcaaacgaatcatttcaacctattccgatctgcctagt gaacgagtgggcgaagcctcgacattggcggagttggatgtggattctattttcgccgtg gagctcattctcgagattgagcaactcttcggcgtgcgtctatcgctggatgagatcgtt gccgacgaaacgctggggatgctggccgatcgaatcatcaatcactcatga

DBGET integrated database retrieval system