Roseovarius indicus: RIdsm_02276 Help Entry RIdsm_02276       CDS       T06222                                  Symbol acpP_1 Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism rid  Roseovarius indicus Pathway rid01100   Metabolic pathways rid01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rid00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     RIdsm_02276 (acpP_1)    00074 Mycolic acid biosynthesis     RIdsm_02276 (acpP_1)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     RIdsm_02276 (acpP_1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N DUF1493 Motif Other DBs NCBI-ProteinID:  QEW26476 UniProt:  A0A0T5P3V4 LinkDB All DBs Position 2428681..2428914 Genome browser AA seq 77 aa AA seqDB search MSDIADRVKKIVVEHLGVEEDKVTENASFIDDLGADSLDTVELVMAFEEEFGIEIPDDAA ETIQTFGDAVKFISEAQ NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgcagaccgcgtgaagaagatcgttgtcgagcaccttggcgtggaagag gacaaggtgacggagaacgcttcgttcatcgacgatctgggcgcagacagcctcgacacg gtcgaattggtcatggcctttgaagaagaattcggcatcgaaattcccgatgacgccgcc gaaaccatccagaccttcggcgacgcggtcaagttcatcagcgaagcccagtaa

DBGET integrated database retrieval system