Roseovarius indicus: RIdsm_04802 Help Entry RIdsm_04802       CDS       T06222                                  Symbol atpE Name (GenBank) Lipid-binding protein   KO K02110   F-type H+-transporting ATPase subunit c Organism rid  Roseovarius indicus Pathway rid00190   Oxidative phosphorylation rid01100   Metabolic pathways Module rid_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:rid00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     RIdsm_04802 (atpE)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:rid00194]     RIdsm_04802 (atpE) Photosynthesis proteins [BR:rid00194]  Photosystem and electron transport system   F-type ATPase [OT]    RIdsm_04802 (atpE) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  QEW28961 UniProt:  A0A0T5PET2 LinkDB All DBs Position complement(4957733..4957969) Genome browser AA seq 78 aa AA seqDB search MEGDIAQMGAYIGAGLASVGMGGAAIGIGHVVGNFLAGALRNPSAAGGQTATMFIGIAFS EALGIFSFLVALLLMFAV NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggaaggcgacatcgcacaaatgggtgcttacatcggtgctggtctggctagcgtcggt atgggcggggccgcaatcggtatcggccacgtggttggtaacttcctcgcgggcgccctg cgcaacccgtcggccgctggtggtcagaccgcgaccatgttcatcggtatcgcgttctcg gaagcgctggggatcttctcgttcctcgtcgcgcttctgctgatgtttgccgtctaa

DBGET integrated database retrieval system