Roseovarius indicus: RIdsm_05288 Help Entry RIdsm_05288       CDS       T06222                                  Name (GenBank) Rod binding protein   KO K02395   peptidoglycan hydrolase FlgJ Organism rid  Roseovarius indicus Pathway rid02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:rid00001]  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     RIdsm_05288  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:rid02035]     RIdsm_05288 Bacterial motility proteins [BR:rid02035]  Flagellar system   Flagellar assembly proteins    Rod and hook     RIdsm_05288 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Rod-binding Motif Other DBs NCBI-ProteinID:  QEW29443 UniProt:  A0A5P3AL03 LinkDB All DBs Position complement(5431516..5431809) Genome browser AA seq 97 aa AA seqDB search MTEISPLSPAQPWVKSDLPLQEARARAAAVALEASFLSEMLKSAGFGSQVNSFSGGAGED HFASFHRDAIARRMVAAGGLGMAEQFFKSMMEAKDGT NT seq 294 nt NT seq  +upstreamnt  +downstreamnt gtgacggaaatttcaccactttccccggcacagccctgggtcaaaagcgatctgcccctg caagaggctcgagcgcgcgccgcggcggtggcgctcgaggccagcttcctttcggaaatg ctcaaatccgccggattcggatcgcaggtcaattcgttctcggggggggcaggcgaagat cacttcgcatctttccaccgcgatgccatcgcccggcgcatggtcgcggcaggagggctc gggatggctgaacagttcttcaaatcgatgatggaggcaaaggatggaacctga

DBGET integrated database retrieval system