Rhizophagus irregularis: OCT59_013112 Help Entry OCT59_013112      CDS       T10295                                  Name (RefSeq) uncharacterized protein   KO K04513   Ras homolog gene family, member A Organism rie  Rhizophagus irregularis Pathway rie04011   MAPK signaling pathway - yeast rie04081   Hormone signaling rie04144   Endocytosis rie04517   IgSF CAM signaling rie04519   Cadherin signaling rie05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:rie00001]  09130 Environmental Information Processing   09132 Signal transduction    04011 MAPK signaling pathway - yeast     OCT59_013112   09133 Signaling molecules and interaction    04081 Hormone signaling     OCT59_013112    04517 IgSF CAM signaling     OCT59_013112    04519 Cadherin signaling     OCT59_013112  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     OCT59_013112  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     OCT59_013112  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:rie04131]     OCT59_013112   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:rie04147]     OCT59_013112    04031 GTP-binding proteins [BR:rie04031]     OCT59_013112 Membrane trafficking [BR:rie04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     OCT59_013112 Exosome [BR:rie04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    OCT59_013112   Exosomal proteins of other body fluids (saliva and urine)    OCT59_013112   Exosomal proteins of colorectal cancer cells    OCT59_013112   Exosomal proteins of bladder cancer cells    OCT59_013112 GTP-binding proteins [BR:rie04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     OCT59_013112 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU SRPRB Motif Other DBs NCBI-GeneID:  36866284 NCBI-ProteinID:  XP_025181617 LinkDB All DBs Position 20:2409578..2412079 Genome browser AA seq 194 aa AA seqDB search MSEIRRKLVIVGDGACGKTCLLIVFSKGTFPEVYVPTVFENYVADVEVDGRHVELALWDT AGQEDYDRLRPLSYPDSHVILICFAVDSPDSLDNVQEKWISEVMHFCQGLPIILVGCKKD LRFDSKTIEELRKTSQRPVTPEEGMGVASKIGAYKYLECSAKTGEGVREVFEHATRAALL AKKKTKRHNMCLVL NT seq 585 nt NT seq  +upstreamnt  +downstreamnt atgtctgagattcgtcggaagcttgtaattgttggggatggtgcttgtggaaagacctgt cttttgattgttttctctaagggtactttccctgaggtgtatgttcccactgtatttgaa aattacgttgcagatgtagaagtagatggaagacatgttgaattggcattatgggataca gctggtcaggaagattatgatcgtcttcgaccactttcttatcccgattctcacgtaatt ttaatttgttttgctgttgactctcctgattccttggataacgtacaggaaaagtggatt tcagaggtaatgcacttctgtcaagggttgcctatcattttggttggttgtaagaaagat ttgaggtttgattctaagacaattgaagagctacgtaaaacgtctcaaagaccagtgaca ccggaagagggaatgggcgttgcatcgaaaattggtgcatacaaatatttggaatgttcg gccaaaacaggtgagggcgtccgtgaggtattcgaacatgccacacgggcggctcttttg gccaagaaaaagacaaaaaggcataatatgtgtttagttttgtag

DBGET integrated database retrieval system