Rhizophagus irregularis: OCT59_014334 Help Entry OCT59_014334      CDS       T10295                                  Name (RefSeq) Rho GTPase protein rac1   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism rie  Rhizophagus irregularis Pathway rie04145   Phagosome rie04148   Efferocytosis rie04620   Toll-like receptor signaling pathway rie05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:rie00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     OCT59_014334    04148 Efferocytosis     OCT59_014334  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     OCT59_014334  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     OCT59_014334  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:rie04131]     OCT59_014334   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:rie04147]     OCT59_014334    04031 GTP-binding proteins [BR:rie04031]     OCT59_014334 Membrane trafficking [BR:rie04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     OCT59_014334  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     OCT59_014334   Macropinocytosis    Ras GTPases     OCT59_014334  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     OCT59_014334 Exosome [BR:rie04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    OCT59_014334   Exosomal proteins of other body fluids (saliva and urine)    OCT59_014334   Exosomal proteins of colorectal cancer cells    OCT59_014334   Exosomal proteins of bladder cancer cells    OCT59_014334 GTP-binding proteins [BR:rie04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     OCT59_014334 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  36869216 NCBI-ProteinID:  XP_025175046 LinkDB All DBs Position 22:448861..450365 Genome browser AA seq 192 aa AA seqDB search MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPINLGLWDTAG QEDYDRLRPLSYPQTDVFLICFSLVSPPSFENVRGKWYPEITHHAPNIPIILVGTKLDLR EDKETILKLRQKAQSPITYPQGLQMAKDIQAVKYLECSALTQKGLKNVFDEAIRAVLCPV PVVGRKSKCMVM NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atgcaagctatcaagtgtgttgtggttggtgatggtgctgtcggtaagacatgtctctta ataagttataccacaaatgcttttcctggagaatatattccaaccgtatttgataattat tcagcaaacgtaatggtcgatggaaagcccatcaaccttggtctttgggatactgctggt caagaagattatgatcgtttacgcccactctcatatcctcaaactgacgtattcttgatt tgcttctctttagtcagccctccttccttcgaaaacgttcggggaaagtggtatcctgaa attactcaccatgcccccaatattccaattatccttgttggtactaagctcgatcttcgt gaggataaggagaccatccttaagctgcgacaaaaagctcagtccccaattacatatcca caaggccttcaaatggcaaaagatatccaagctgttaaatatcttgaatgttctgctctt acccaaaaaggattaaaaaacgtttttgatgaagccattagggccgtactttgtcctgtc ccagtagtaggcagaaagagtaaatgtatggttatgtaa

DBGET integrated database retrieval system