Rhizophagus irregularis: OCT59_018144 Help Entry OCT59_018144      CDS       T10295                                  Name (RefSeq) Dynein light chain Tctex-type   KO K10418   dynein light chain LC8-type Organism rie  Rhizophagus irregularis Pathway rie04145   Phagocytosis rie04517   IgSF CAM signaling rie04814   Motor proteins Brite KEGG Orthology (KO) [BR:rie00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     OCT59_018144  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     OCT59_018144   09142 Cell motility    04814 Motor proteins     OCT59_018144  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:rie03037]     OCT59_018144    04812 Cytoskeleton proteins [BR:rie04812]     OCT59_018144 Cilium and associated proteins [BR:rie03037]  Motile cilia and associated proteins   Dynein arm    OCT59_018144 Cytoskeleton proteins [BR:rie04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      OCT59_018144 SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Motif Other DBs NCBI-GeneID:  36868287 NCBI-ProteinID:  XP_025177128 LinkDB All DBs Position 27:complement(1072835..1073909) Genome browser AA seq 90 aa AA seqDB search MSSEEKPTIKNVDMTDEMQQEAIDCARQALEKYNIEKDIAAHIKREFDKRHGTTWHCIVG RNFGSYVTHETKHFIYFYIGNIAILLFKSG NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgtcttctgaagaaaagccaaccatcaagaatgttgacatgaccgatgagatgcagcag gaagctatagattgtgctaggcaagcgttggaaaaatataatattgagaaagatattgca gctcatattaaacgtgaattcgataaaagacacggaacaacttggcactgtatcgttgga agaaatttcggaagctacgtgactcacgaaaccaagcatttcatctacttttacattgga aatattgctatactcctgttcaaatctggataa

DBGET integrated database retrieval system