Rhizophagus irregularis: OCT59_018191 Help Entry OCT59_018191      CDS       T10295                                  Name (RefSeq) uncharacterized protein   KO K03358   anaphase-promoting complex subunit 11 Organism rie  Rhizophagus irregularis Pathway rie04111   Cell cycle - yeast rie04113   Meiosis - yeast rie04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:rie00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     OCT59_018191  09140 Cellular Processes   09143 Cell growth and death    04111 Cell cycle - yeast     OCT59_018191    04113 Meiosis - yeast     OCT59_018191  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:rie04121]     OCT59_018191    03036 Chromosome and associated proteins [BR:rie03036]     OCT59_018191 Ubiquitin system [BR:rie04121]  Ubiquitin ligases (E3)   Multi subunit type E3    APC/C     Ring finger protein      OCT59_018191 Chromosome and associated proteins [BR:rie03036]  Eukaryotic type   Sister chromatid separation proteins    APC/C complex     OCT59_018191 SSDB OrthologParalogGFIT Motif Pfam:  zf-ANAPC11 zf-rbx1 zf-RING_2 zf-C3HC4 zf-RING_UBOX zf_RING_Vps8_fungal zf-RING_16 zf-C3HC4_2 Motif Other DBs NCBI-GeneID:  36873618 NCBI-ProteinID:  XP_025170504 UniProt:  A0ACH0HHY6 LinkDB All DBs Position 27:1268033..1268722 Genome browser AA seq 85 aa AA seqDB search MRVKVKRWHGVAVWRWDVPNEEVCGICRVPFDGCCPTCKTPGDDCSLIWGECTHVFHMHC LLRWLQTEGSRGQCPMDRRTWVTAR NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgagagttaaagtgaaacgttggcatggagttgcagtttggaggtgggatgtacctaac gaggaagtttgtggaatatgtagagtgccctttgacggttgttgtcctacctgtaaaact cctggagacgattgttcgctaatttggggagagtgtacacacgtgtttcatatgcattgt ttattaaggtggctccaaacggaaggaagtcgtggacaatgtccaatggatcgcaggaca tgggttactgctagatag

DBGET integrated database retrieval system