Rhizobium indigoferae: U5G49_001238 Help Entry U5G49_001238      CDS       T09660                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism rif  Rhizobium indigoferae Pathway rif00998   Biosynthesis of various antibiotics rif01100   Metabolic pathways rif01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rif00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     U5G49_001238    00074 Mycolic acid biosynthesis     U5G49_001238   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     U5G49_001238 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N ACP_SdgA_C Delta_lysin Motif Other DBs NCBI-ProteinID:  WQN36177 UniProt:  A0ABZ0ZC28 LinkDB All DBs Position 1202480..1202716 Genome browser AA seq 78 aa AA seqDB search MSDIAERVKKIVIDHLGVDADKVVESASFIDDLGADSLDTVELVMAFEEEFGVEIPDDAA DSILTVGDAVKFIEKAQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgcagaacgcgtaaagaaaattgttattgatcatcttggcgttgatgcc gacaaggtcgtcgagagcgccagctttatcgacgatctgggcgctgactcgctcgacacg gtcgaacttgtcatggctttcgaagaagaattcggcgttgaaattcctgacgacgctgcc gactcgatcctgacggtcggcgatgcagtgaagtttattgagaaggcccaggcctga

DBGET integrated database retrieval system