Romboutsia ilealis: CRIB_36 Help Entry CRIB_36           CDS       T09982                                  Name (GenBank) DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism ril  Romboutsia ilealis Brite KEGG Orthology (KO) [BR:ril00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:ril03032]     CRIB_36    03036 Chromosome and associated proteins [BR:ril03036]     CRIB_36    03400 DNA repair and recombination proteins [BR:ril03400]     CRIB_36 DNA replication proteins [BR:ril03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     CRIB_36 Chromosome and associated proteins [BR:ril03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     CRIB_36 DNA repair and recombination proteins [BR:ril03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       CRIB_36 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_1 HU-CCDC81_euk_2 Peptidase_C80 TFIIB HU-DNA_bdg Glycos_trans_3N HPTransfase Arteri_nsp7a Motif Other DBs NCBI-ProteinID:  CED92795 UniProt:  A0A1V1HXV6 LinkDB All DBs Position 1:42176..42454 Genome browser AA seq 92 aa AA seqDB search MNKAELVSKMAEKSELTKKEAEAALNAFMKSVEEALVSGDKVQLVGFGTFETRERAARQG RNPRNPEEVIEIPASKAPVFKAGKGLKDIING NT seq 279 nt NT seq  +upstreamnt  +downstreamnt gtgaataaagcagaattagtatcaaagatggcagaaaaaagtgaattaactaagaaggaa gcagaggctgcgttaaatgcattcatgaaatctgttgaagaagcattagtatcaggagat aaagttcaattagttggatttggaacattcgaaactagagaaagagctgctagacaagga agaaatcctagaaatcctgaagaagttatagaaataccagcttctaaagctccagttttc aaagctggaaaaggattaaaagatataataaacggataa

DBGET integrated database retrieval system