Ralstonia insidiosa: ACS15_0318 Help Entry ACS15_0318        CDS       T04471                                  Symbol grxC Name (GenBank) glutaredoxin 3   KO K03676   glutaredoxin 3 Organism rin  Ralstonia insidiosa Brite KEGG Orthology (KO) [BR:rin00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:rin03110]     ACS15_0318 (grxC) Chaperones and folding catalysts [BR:rin03110]  Protein folding catalysts   Protein disulfide isomerase    ACS15_0318 (grxC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 Glrx-like GST_N_2 TXD17-like_Trx Motif Other DBs NCBI-ProteinID:  ANH73021 UniProt:  A0AAC9BF81 LinkDB All DBs Position 1:317090..317332 Genome browser AA seq 80 aa AA seqDB search MYSTTVCPYCVAAERLLKQRGVEQIEKILIDREPGKREEMMTRTNRRTVPQIYIDDRHIG GFDDLSALDREGGLVPLLAA NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgtacagcaccaccgtctgcccctattgcgtggcagcggaacgactcctgaagcagcgc ggcgtcgaacagatcgaaaagatcctgatcgaccgcgaacccggcaaacgcgaagagatg atgacgcgcacgaaccgtcgcaccgtgccgcagatctacatcgacgatcgccacattggc ggcttcgatgatctctctgcgctggaccgcgaaggcgggctggtgccactgctggcggcc tga

DBGET integrated database retrieval system