KEGG   Ralstonia insidiosa: ACS15_3871
Entry
ACS15_3871        CDS       T04471                                 
Symbol
gabP
Name
(GenBank) GABA permease
  KO
K11735  GABA permease
Organism
rin  Ralstonia insidiosa
Brite
KEGG Orthology (KO) [BR:rin00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rin02000]
    ACS15_3871 (gabP)
Transporters [BR:rin02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   ACS15_3871 (gabP)
SSDB
Motif
Pfam: AA_permease AA_permease_2
Other DBs
NCBI-ProteinID: ANH71638
UniProt: A0AAC9BCX1
LinkDB
Position
1:3921119..3922501
AA seq 460 aa
MTGSKSGLSSGLKPRHVTMLSIAGVIGAGLFVGSGHAIAKAGPAAIVAYGIAGLLVVLVM
RMLGEMAVAHPDTGSFSTYADRAIGHWAGFSIGWLYWWFWVLVIPIEATAAALILNTWFS
DVATWVFALGVTFVLTLTNLFSVKNYGEFEFWFALIKVVAIVIFLAVGGAAVLGLLPGSG
VSGAARLLDVGGFMPNGFGAVLAALLTTMFTFLGTEIVTIAAAESADPSRQIVRATKSVI
WRICLFYLGSIFVVTALVPWNDPLLAAHGSYQRALELIGVPHAKAIVDVIVLVSVASCLN
SALYTASRMLFSLSVRGDAPAALRRTDANGTPRAAVLASTAFGFLTVIANYVMPEQVFSF
LLATSGAIALLVYMAIAISQLRMRASLDASGVSTPLRMWLFPWLTWAVILFICGVLLAML
ILPGLRTEVIATAILAALVFVAAWLNQRKRTVLTAQPANA
NT seq 1383 nt   +upstreamnt  +downstreamnt
atgacaggatcaaagtcaggcctgagttcaggcctgaagccgcgccacgtgaccatgctg
tcgattgcaggcgtgatcggcgcgggtttgtttgtgggctccgggcacgcgattgccaaa
gcggggccggcagccattgtcgcgtatggcatcgccggtttgctggtggtgttggtcatg
cgcatgctgggtgaaatggccgtggcgcatccggataccggttcgttttccacctatgcc
gaccgagccatcgggcactgggcgggctttagcatcggctggctgtactggtggttctgg
gtgctggtgatcccgatcgaggccaccgccgctgcactcatcctcaacacgtggttttcc
gatgtggccacctgggtctttgcgttgggtgtgacgttcgtgctcacgctcaccaacctg
ttctcggtcaagaactacggcgaattcgaattctggtttgcgctcatcaaggtggtggcc
atcgtcatcttcctggcggtcggtggcgcggcggtgctgggcttgctgccgggctccggc
gtgtcgggcgcggcgcggctgctggatgtgggcggcttcatgcccaacggctttggtgcc
gtgctggcggcattgctgacgacgatgttcacctttctcggcaccgagatcgtcaccatt
gcggcggcagagtccgctgacccatcgcgccagatcgtgcgcgccaccaagtcggtcatc
tggcgcatctgcctgttctacctgggctcgatcttcgtggtgacggcgctggtaccgtgg
aacgatccgctgctggcggcgcatggctcttaccagcgtgcgctggaattgattggcgtg
ccgcatgccaaggccatcgtcgatgtgatcgtgctggtgtcggtggcgagctgcctgaat
tcggcgctgtacacggcgtcgcgcatgctgttttcgctgtcggtgcgcggtgatgcgccg
gccgccttgcgccggacagatgccaacggcacgccgcgtgcagccgtgctggcctccacc
gcgttcggctttctcacggtcattgccaactacgtgatgccggagcaggtgttctccttc
ctgttggctacgtcgggggcgattgcgctgctggtgtacatggcgattgcaatctcgcaa
ttgcgcatgcgggcgtcgttggatgcgtctggggtgagcacaccgctgcgcatgtggctg
ttcccgtggctgacgtgggcagtcatcctcttcatctgtggggtgctgctggccatgttg
atcctcccgggcctgcgcaccgaggtgattgccacggcgattctcgctgcgcttgtgttc
gtggccgcttggctgaaccagcgcaagcgcacggtgctcaccgcccagcccgcaaacgcg
tga

DBGET integrated database retrieval system