Ralstonia insidiosa: ACS15_4319 Help Entry ACS15_4319        CDS       T04471                                  Name (GenBank) H-NS histone family protein   KO K03746   DNA-binding protein H-NS Organism rin  Ralstonia insidiosa Brite KEGG Orthology (KO) [BR:rin00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:rin03036]     ACS15_4319    03400 DNA repair and recombination proteins [BR:rin03400]     ACS15_4319 Chromosome and associated proteins [BR:rin03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     ACS15_4319 DNA repair and recombination proteins [BR:rin03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       ACS15_4319 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS TfoX_N Motif Other DBs NCBI-ProteinID:  ANH75659 UniProt:  A0AAC9FSZ6 LinkDB All DBs Position 2:441858..442100 Genome browser AA seq 80 aa AA seqDB search MTLRRRAEAITWVRLQIARYGLTYADLAAAGAFPSRQRNQLKVRYRTADGQTWDGEGEMP DWLKRAVNAGQSAEHFRADT NT seq 243 nt NT seq  +upstreamnt  +downstreamnt gtgacgctgcgccgccgcgccgaggcgattacgtgggttcggctgcagatcgcgcgctac gggctgacgtatgccgacctggcggcggcaggcgcgttcccatcgcggcagcgaaaccag ctgaaggtgcgctatcgcaccgcggatggccagacctgggacggggagggcgagatgccc gactggctcaagcgggccgtcaatgccggccaaagtgcggagcatttccgggccgatacc tga

DBGET integrated database retrieval system