Rahnella inusitata: I2123_06505 Help Entry I2123_06505       CDS       T09790                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism riu  Rahnella inusitata Pathway riu01100   Metabolic pathways riu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:riu00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     I2123_06505    00074 Mycolic acid biosynthesis     I2123_06505   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     I2123_06505 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QUT16442 LinkDB All DBs Position 1382990..1383247 Genome browser AA seq 85 aa AA seqDB search MDSLSHEIKELIITTLNLEGMTPDEIETEAPLFGDGLGLDSIDALELGLAFKKQYGVTLS AESQEMRQHFYSVESLARFISVQRG NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atggattcattaagtcacgagataaaagaactgatcattacgaccctcaatctggaggga atgacgccggatgagatagagacagaggcgccgcttttcggtgatggtttgggactcgat tctattgatgcccttgaattaggtttggcttttaaaaagcaatacggcgtgaccctttcg gcagaaagccaggaaatgcgccagcatttttattctgtagaaagcctcgcccggtttata tcagtgcagcgtggttaa

DBGET integrated database retrieval system