Rahnella inusitata: I2123_25120 Help Entry I2123_25120       CDS       T09790                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism riu  Rahnella inusitata Pathway riu01100   Metabolic pathways riu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:riu00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     I2123_25120    00074 Mycolic acid biosynthesis     I2123_25120   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     I2123_25120 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QUT18066 LinkDB All DBs Position unnamed2:108250..108510 Genome browser AA seq 86 aa AA seqDB search MLNRDEVMDYILTCLQDIVKGEVDVRPDSDLVNDLGLESIRVMDLLMMLEDKLDISIPIN ILLDVRTPEQLLVALQPHLENANGPV NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgctaaatcgcgacgaagtgatggattatattcttacctgcttacaggacatcgttaaa ggtgaggtggatgtcaggccggacagcgatcttgtcaacgatcttggcctggaatcaatc agagtgatggatttgctgatgatgctggaagacaaactggatatttctattccgattaac atcctgctcgatgtcagaacgcctgagcaattgcttgtcgcgctgcaacctcacctggag aacgccaatgggcctgtatga

DBGET integrated database retrieval system