Rothia kristinae: I6G21_00065 Help Entry I6G21_00065       CDS       T06977                                  Symbol atpE Name (GenBank) ATP synthase F0 subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism rkr  Rothia kristinae Pathway rkr00190   Oxidative phosphorylation rkr01100   Metabolic pathways Module rkr_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:rkr00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     I6G21_00065 (atpE)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:rkr00194]     I6G21_00065 (atpE) Photosynthesis proteins [BR:rkr00194]  Photosystem and electron transport system   F-type ATPase [OT]    I6G21_00065 (atpE) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  QPT53663 UniProt:  A0A147E761 LinkDB All DBs Position complement(12623..12826) Genome browser AA seq 67 aa AA seqDB search MVGSLSVIGFGLAAIGGGIGVGLIFAAYMTSVARQPESQRVLQPMLFLGFAVVEALAILG FVLALIK NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atggtaggttcgctcagcgtcatcggcttcggtctggcagcgatcggcggcggcatcggc gtcggcctgatcttcgccgcgtacatgacctccgtggctcgccagccggagtcccagcgc gtgctgcagcccatgctgttcctcggcttcgccgtggtcgaggccctggccatcctgggc ttcgttctggccctgatcaagtag

DBGET integrated database retrieval system