Rothia kristinae: I6G21_10060 Help Entry I6G21_10060       CDS       T06977                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism rkr  Rothia kristinae Pathway rkr01100   Metabolic pathways rkr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rkr00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     I6G21_10060    00074 Mycolic acid biosynthesis     I6G21_10060   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     I6G21_10060 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  QPT53571 UniProt:  A0A147E9S2 LinkDB All DBs Position 2278393..2278638 Genome browser AA seq 81 aa AA seqDB search MADKNEILAGLAEIVNEETGVETEEVQLEKSFTEDLDIDSISMMTIVVNAEEKFGVTIPD EEVKNLKTVGDAVDFIANASN NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atggctgacaagaacgagatcctcgccggactggccgagatcgtcaacgaggagaccggt gtggagaccgaggaggtccagctggagaagtccttcaccgaggacctggacatcgactcc atctccatgatgaccatcgtcgtcaacgcggaggagaagttcggggtgaccatcccggat gaggaggtcaagaacctcaagaccgtcggcgacgccgtcgacttcatcgccaacgcctcc aactga

DBGET integrated database retrieval system