Rhodomicrobium lacus: QMO75_04295 Help Entry QMO75_04295       CDS       T09241                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism rlac  Rhodomicrobium lacus Pathway rlac01100   Metabolic pathways rlac01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rlac00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     QMO75_04295    00074 Mycolic acid biosynthesis     QMO75_04295   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     QMO75_04295 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N DUF7080 DUF1493 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  WKW51710 LinkDB All DBs Position complement(991819..992061) Genome browser AA seq 80 aa AA seqDB search MSDISDRVKKIVIEHLGVEADKVTENASFIDDLGADSLDTVELVMAFEEEFGVEIPDDAA ETIQTVGDAIRFLESHSTKA NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatctcggaccgcgttaaaaaaatcgtcatcgaacatcttggcgtcgaagcc gacaaggtcactgaaaatgccagcttcatcgacgatctcggcgcggacagcctggacacg gtcgaactcgtgatggcgttcgaggaagaattcggtgtggaaatcccggacgatgccgct gagacgattcagaccgtcggcgatgccatccgcttcctggaaagccattccacgaaggcc taa

DBGET integrated database retrieval system