Rhizobium johnstonii: RL2284 Help Entry RL2284            CDS       T00402                                  Symbol hfq Name (GenBank) putative host factor protein   KO K03666   host factor-I protein Organism rle  Rhizobium johnstonii Pathway rle02024   Quorum sensing rle03018   RNA degradation Brite KEGG Orthology (KO) [BR:rle00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     RL2284 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     RL2284 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:rle03019]     RL2284 (hfq)    03036 Chromosome and associated proteins [BR:rle03036]     RL2284 (hfq) Messenger RNA biogenesis [BR:rle03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      RL2284 (hfq) Chromosome and associated proteins [BR:rle03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     RL2284 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq Hfq_1 LSM Motif Other DBs NCBI-ProteinID:  CAK07776 UniProt:  Q1MGZ1 LinkDB All DBs Position 2406959..2407201 Genome browser AA seq 80 aa AA seqDB search MAERSQNLQDLFLNTVRKQKISLTIFLINGVKLTGVVTSFDNFCVLLRRDGHSQLVYKHA ISTIMPGQPMQMFESEEAAS NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atggcggaacgttctcagaatcttcaggacttatttctcaatactgttcgcaagcaaaag atttccctgacaatctttctgatcaacggcgtgaaactcacgggcgttgttacgtctttt gacaatttctgtgttcttcttcgccgtgacggccattcgcagctcgtgtataagcatgcg atctcgacgatcatgccgggccagcccatgcagatgttcgagagcgaagaagcagcgtcc taa

DBGET integrated database retrieval system