Rhizobium lusitanum: HB780_31885 Help Entry HB780_31885       CDS       T07787                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism rls  Rhizobium lusitanum Pathway rls01100   Metabolic pathways rls01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rls00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HB780_31885    00074 Mycolic acid biosynthesis     HB780_31885   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HB780_31885 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N Delta_lysin DUF7080 Motif Other DBs NCBI-ProteinID:  QND50066 LinkDB All DBs Position 3723525..3723761 Genome browser AA seq 78 aa AA seqDB search MSDTAERVKKIVIDHLGVDADKVVEGASFIDDLGADSLDTVELVMAFEEEFGVEIPDDAA DSILTVGDAVKFIEKAQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgataccgcagaacgcgtaaagaaaattgttattgatcatcttggcgttgacgcc gacaaggttgttgaaggcgccagcttcatcgacgacctgggcgctgactcgctcgacacc gtcgaactggtcatggccttcgaagaagaattcggcgttgaaattcccgatgacgctgcc gactcgatcctgacggtcggtgatgcggtaaagttcattgaaaaggcccaggcctaa

DBGET integrated database retrieval system