KEGG   Rhizobium laguerreae: RlegWSM1455_22260
Entry
RlegWSM1455_22260 CDS       T08814                                 
Symbol
truB
Name
(GenBank) tRNA pseudouridine(55) synthase TruB
  KO
K03177  tRNA pseudouridine55 synthase [EC:5.4.99.25]
Organism
rlw  Rhizobium laguerreae
Brite
KEGG Orthology (KO) [BR:rlw00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:rlw03016]
    RlegWSM1455_22260 (truB)
Enzymes [BR:rlw01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.25  tRNA pseudouridine55 synthase
     RlegWSM1455_22260 (truB)
Transfer RNA biogenesis [BR:rlw03016]
 Eukaryotic type
  tRNA modification factors
   Psudouridine synthases
    RlegWSM1455_22260 (truB)
 Prokaryotic type
    RlegWSM1455_22260 (truB)
SSDB
Motif
Pfam: TruB_N TruB_C_2 TruB-C_2 TruB_C
Other DBs
NCBI-ProteinID: UFW64189
LinkDB
Position
complement(4485467..4486399)
AA seq 310 aa
MSKPRKPKGRPISGWLILDKPVDFGSTEAVSKIKWLYKAEKAGHAGTLDPLASGMLPIAL
GDATKTVPYVMDGRKIYEFTVSWGEERATDDLEGAVTKSSDKRPSEQQIRDILSGYIGTI
SQVPPQFSAIKIAGERAYDLAREGETVEIPSREVDIFRLTLLACPDADSAHFEVECGKGT
YVRALARDFGRELGCYGHVSGLRRTFVAPFAEEAMVPLADLVALEAIEDMDERLAALDAL
LINTCEALSSLPRLVINDDQAHRLKMGNPILVRGRDAPVAESEAYATARGKLIAIGEIGQ
GEFRPKRVFA
NT seq 933 nt   +upstreamnt  +downstreamnt
atgtccaaaccacgcaaacccaaaggccggccgatttccggctggctgatcctcgacaag
ccggtggatttcggctcgacggaagccgtctccaagatcaagtggctctacaaggccgag
aaggccggccatgccggcacgctcgatccgctcgcctccggcatgctgccgatcgcgctc
ggtgacgcgacgaagaccgtcccctacgtgatggatggccgcaagatctatgaattcacg
gtgagctggggcgaggagcgcgcgaccgacgatcttgagggcgcggtgaccaagagttcg
gacaaacgcccgagcgaacagcagatccgcgatatcctgtctggatatatcggcacgatc
agccaggtgccgccgcagttttccgcgatcaagatcgcaggtgaacgcgcctatgatctg
gcgcgcgaaggcgaaaccgtcgaaatcccctcgcgtgaggtcgatatcttccggctgacc
ttgctcgcctgcccggacgccgatagcgcgcatttcgaagtggaatgcggcaagggcacc
tatgtcagggcgctggcgcgtgatttcggccgcgagctcggctgctacggccatgtgtcc
gggctgcggcgcaccttcgtcgcgcctttcgcggaagaggccatggtgccgctcgcggat
ctcgtggcactggaagcgatcgaggatatggacgagcggctggcggccctcgacgcgctg
ctgatcaacacctgcgaagcgctgtcctccctgccccgtctcgtcatcaacgatgaccag
gcgcaccggttgaagatgggcaacccgatcctggtgcgtggccgcgatgcgccggttgcc
gaaagcgaagcttatgcgacggcccgcggcaagctgatcgcgatcggcgagatcggccag
ggcgagttccgcccgaagcgggttttcgcctga

DBGET integrated database retrieval system