Rubrobacter marinus: GBA65_13360 Help Entry GBA65_13360       CDS       T07670                                  Name (GenBank) hypothetical protein   KO K03116   sec-independent protein translocase protein TatA Organism rmar  Rubrobacter marinus Pathway rmar03060   Protein export rmar03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:rmar00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     GBA65_13360  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     GBA65_13360  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:rmar02044]     GBA65_13360 Secretion system [BR:rmar02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    GBA65_13360 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E Motif Other DBs NCBI-ProteinID:  QIN79334 UniProt:  A0A6G8PYL0 LinkDB All DBs Position 2629441..2629668 Genome browser AA seq 75 aa AA seqDB search MSIGPFEILLVLAVLALIIGPRRVTDMAKSFGRGVQEFVAEIGDKGSDSKREAIGDGDEK ADEKDKEATKGTNKR NT seq 228 nt NT seq  +upstreamnt  +downstreamnt gtgagcatcgggcccttcgagatcctgctcgtcctcgccgtcctcgcgctcatcataggc cctcgccgcgtcacggacatggcaaagtcgttcggccgcggcgtccaggaatttgtcgcg gagatcggggacaaggggtccgactccaagcgtgaggccatcggcgacggcgacgagaaa gcggacgagaaggacaaagaagctaccaaagggacgaacaaacgctag

DBGET integrated database retrieval system