Rhopalosiphum maidis (corn leaf aphid): 113549643 Help Entry 113549643         CDS       T06065                                  Name (RefSeq) ras-related protein Rac1   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism rmd  Rhopalosiphum maidis (corn leaf aphid) Pathway rmd04013   MAPK signaling pathway - fly rmd04145   Phagosome rmd04148   Efferocytosis rmd04310   Wnt signaling pathway rmd04620   Toll-like receptor signaling pathway rmd05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:rmd00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     113549643    04310 Wnt signaling pathway     113549643  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     113549643    04148 Efferocytosis     113549643  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     113549643  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     113549643  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:rmd04131]     113549643   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:rmd04147]     113549643    04031 GTP-binding proteins [BR:rmd04031]     113549643 Membrane trafficking [BR:rmd04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     113549643  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     113549643   Macropinocytosis    Ras GTPases     113549643  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     113549643 Exosome [BR:rmd04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    113549643   Exosomal proteins of other body fluids (saliva and urine)    113549643   Exosomal proteins of colorectal cancer cells    113549643   Exosomal proteins of bladder cancer cells    113549643 GTP-binding proteins [BR:rmd04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     113549643 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  113549643 NCBI-ProteinID:  XP_026806840 LinkDB All DBs Position 4:11692764..11696195 Genome browser AA seq 192 aa AA seqDB search MQAIKCVVVGDGAVGKTCLLISYTSNAFPGEYIPTVFDNYSANVMVDGKPINLGLWDTAG QEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPSTPIILVGTKLDLR EDKETIDKLKEKKLTAITYPQGLSMAKEIGAVKYLECSALTQKGLKIVFDEAIRAVLCPV LPVKPKRKCTII NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atgcaagccatcaagtgtgttgtagtcggcgacggagcggttggtaaaacatgtttactc attagttatacaagcaatgcatttcctggagaatacatacctactgtatttgacaactat tcagccaatgtcatggttgatggaaaacctataaacttaggattatgggatactgctggt caagaagattatgataggcttaggcctctttcatatccacaaacagatgtgtttctcata tgtttttcattagtaaatcctgcttcatttgaaaatgtgcgggcaaaatggtatcctgaa gttcgacatcattgcccaagtactccaattattttagttggtacaaaacttgatttacga gaagataaagaaacaattgataaactgaaagaaaaaaagttaactgctattacatatcca cagggtttatcaatggccaaagaaattggagcagtgaaatacttggaatgtagtgctttg actcaaaaaggtctaaaaattgtttttgatgaagccattagagcagttttatgtcctgta ctgccagttaagccaaaacgtaaatgcacaataatttaa

DBGET integrated database retrieval system