KEGG   Rhopalosiphum maidis (corn leaf aphid): 113552021
Entry
113552021         CDS       T06065                                 
Name
(RefSeq) cytochrome P450 306a1-like
  KO
K10720  ecdysteroid 25-hydroxylase [EC:1.14.-.-]
Organism
rmd  Rhopalosiphum maidis (corn leaf aphid)
Pathway
rmd00981  Insect hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:rmd00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    113552021
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:rmd00199]
    113552021
Enzymes [BR:rmd01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     113552021
Cytochrome P450 [BR:rmd00199]
 Cytochrome P450, animal type
  CYP306 family
   113552021
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 113552021
NCBI-ProteinID: XP_026810473
LinkDB
Position
2:complement(19489067..19521245)
AA seq 492 aa
MFWIIGVILLGALYASYLWRSNRNLPPGPWGVPILGYLPWLNPTQPYKTLTALAYKYGPI
YSIQMGKHFAVVMSDPTLVRKELARNELADRTNFEVVNEIMQEHGLIFTRGPLWKEQRKF
VCNWLKEIGVSKFGEKKNNLQLLISDVVSASISKLRQSNESPIDTGTFFLVHVGDFINLK
VLGKAWPEDDPNWIYLRNLAEDGSKKFAIATPLSVLPILKVIPKYRNTVFEVVEGVKNTH
CIYKTLMEKRGNEINECDDLMAMFMKEMTKRINNTDSHFFTEKQCCFLLSDIFGAGVETT
VNTLRWFLLYMALNKKIQNDVQKLLDSACTNNGIIDLEQIESIPLLKACVSETMRLRPVA
PSGIPRSVNSEITILGYRIPKGTMVLPLQWAMHHNEKYWTDPQVFQPKRFLDDKGNMIHN
KAFMPFQAGKRACVGDTLSYWLLYLFGANIIHNFNVSIEDGLSEKEINTIMDGEFGITLS
PATHNIVFKSRI
NT seq 1479 nt   +upstreamnt  +downstreamnt
atgttttggatcattggtgtaatattactcggtgcgttgtatgctagttatctatggcga
tccaacagaaacttacctccaggcccttggggtgttccaatcctcggctatctgccatgg
ctaaatcctacacaaccttacaaaacgttgacggcactggcatataagtatggaccaatt
tacagtattcaaatggggaaacattttgcagtagttatgtcggatccaacattggttaga
aaggaattagcacgaaatgaacttgccgatcgcactaatttcgaagttgtcaacgaaatc
atgcaagaacatggtctgatatttacacgcggacctctttggaaagaacagcgaaaattt
gtttgcaattggcttaaggaaattggcgtgtctaagtttggggagaagaaaaataactta
caactacttatttccgacgtcgtgtctgcttcaatttcgaaattacgacagtcaaatgaa
agtccaattgacacaggaactttttttctagtacacgtaggagatttcataaatctcaaa
gtgttgggtaaagcgtggccagaagatgaccctaattggatttatttaagaaatttggct
gaagatggatccaaaaaatttgctatagctacgccattgagtgttttgccaatattgaag
gtaataccgaagtacagaaatactgtttttgaagtagtcgagggagttaaaaatacgcat
tgcatatataaaacattgatggaaaaacgaggtaacgaaatcaatgaatgtgacgatctg
atggctatgttcatgaaagaaatgacaaaaagaataaacaacacggattcccacttcttc
accgaaaaacaatgttgttttcttctgtctgatatttttggtgctggtgtagaaactacc
gtgaataccctaagatggtttcttctttatatggctttaaataaaaaaatacagaacgac
gtacagaaattgttggattctgcatgcaccaataacggaataatagatttagagcagatt
gaaagcattccattgctaaaagcttgtgtgtctgaaactatgcgtttacggccagtagct
ccatctggaataccccgatcggtcaacagcgaaattacaattttaggttaccgcatacca
aaagggaccatggttttacctctgcagtgggcaatgcaccacaacgaaaagtattggacg
gacccgcaagtatttcaaccgaaaagatttttagatgacaaaggaaatatgatacacaac
aaagcgttcatgccatttcaagccggtaaaagagcttgtgttggagacacgctttcctat
tggttactctatttattcggtgcaaatattattcataatttcaatgtttccatagaagac
ggtctatctgaaaaagaaattaacaccatcatggatggggagtttggcataacgctcagt
ccggctacgcacaacattgtttttaaatctcgaatttaa

DBGET integrated database retrieval system