Rhopalosiphum maidis (corn leaf aphid): 113554084 Help Entry 113554084         CDS       T06065                                  Name (RefSeq) ubiquitin-like   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism rmd  Rhopalosiphum maidis (corn leaf aphid) Pathway rmd03010   Ribosome rmd04120   Ubiquitin mediated proteolysis rmd04137   Mitophagy - animal rmd04140   Autophagy - animal Brite KEGG Orthology (KO) [BR:rmd00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     113554084   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     113554084  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     113554084    04137 Mitophagy - animal     113554084  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:rmd03011]     113554084    04121 Ubiquitin system [BR:rmd04121]     113554084   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:rmd04147]     113554084 Ribosome [BR:rmd03011]  Ribosomal proteins   Eukaryotes    Small subunit     113554084   Archaea     113554084 Ubiquitin system [BR:rmd04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    113554084 Exosome [BR:rmd04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    113554084   Exosomal proteins of colorectal cancer cells    113554084 SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Ribosomal_S27 Rad60-SLD Ubiquitin_2 Rad60-SLD_2 Plexin_RBD DUF2604 Dsc3_N UBL_UBAC1 Ubiquitin_5 TBK1_ULD Motif Other DBs NCBI-GeneID:  113554084 NCBI-ProteinID:  XP_026813572 LinkDB All DBs Position 2:66961339..66964233 Genome browser AA seq 150 aa AA seqDB search MQIFVKTLTGKTITLEVESSDSIENVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN IQKESTLHLVLRLRGGAKKRKKKNYSTPKKIKHKKRKIKLAVLKFYKVDENGKVIRLKKE CTSENCGPGVFMADMPNRHYCGKCSATVPK NT seq 453 nt NT seq  +upstreamnt  +downstreamnt atgcaaatcttcgtgaagactttgacggggaaaacgatcactctcgaagtagagtcatcg gattcaattgaaaatgttaaatccaaaattcaagataaagaaggtattcctccggatcag caacgtttgatatttgccggcaaacaacttgaagatgggcgcactctgtcagattacaac attcaaaaagaatctacccttcacttggttcttagattgagaggaggtgctaagaaacgt aagaagaagaattattctacacccaaaaagatcaagcacaagaaaaggaagattaagtta gctgtgttgaaattttacaaagttgatgaaaacggtaaagttatccgtttgaagaaagaa tgtacttctgaaaattgtggtcccggtgtgttcatggctgacatgccaaataggcattac tgtggcaaatgctcagctactgtacctaagtag

DBGET integrated database retrieval system