Rhopalosiphum maidis (corn leaf aphid): 113559237 Help Entry 113559237         CDS       T06065                                  Name (RefSeq) DNA polymerase epsilon subunit 3   KO K02326   DNA polymerase epsilon subunit 3 [EC:2.7.7.7] Organism rmd  Rhopalosiphum maidis (corn leaf aphid) Pathway rmd03030   DNA replication rmd03082   ATP-dependent chromatin remodeling rmd03410   Base excision repair rmd03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:rmd00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     113559237    03410 Base excision repair     113559237    03420 Nucleotide excision repair     113559237   09126 Chromosome    03082 ATP-dependent chromatin remodeling     113559237  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:rmd03032]     113559237    03036 Chromosome and associated proteins [BR:rmd03036]     113559237    03400 DNA repair and recombination proteins [BR:rmd03400]     113559237 Enzymes [BR:rmd01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      113559237 DNA replication proteins [BR:rmd03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase epsilon complex     113559237 Chromosome and associated proteins [BR:rmd03036]  Eukaryotic type   Chromatin remodeling factors    CHRAC complex     113559237 DNA repair and recombination proteins [BR:rmd03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase epsilon complex       113559237 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CBFD_NFYB_HMF Histone CENP-T_C YlbD_coat TFIID_20kDa Motif Other DBs NCBI-GeneID:  113559237 NCBI-ProteinID:  XP_026820688 LinkDB All DBs Position 4:22136359..22138270 Genome browser AA seq 126 aa AA seqDB search MAERLEDLNLPVTAITRIAKEVLPANIIVSKEAKTALARAASVFILYVSNQATTIATSRN KKTISAQDVLEALSQVDFGCLIEPLQQLLEDFKSTKQQKKDTKKPTPNKNTDDADVIDLV DDDLEL NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atggccgaacgtctggaagatttaaatctaccggtgacggcgatcactcgtatcgctaag gaagtgttaccagccaacatcattgtgtcaaaagaagccaagaccgcgttggccagagcg gcgtccgtattcatattgtacgtaagcaatcaagctaccacgatcgcaaccagcaggaac aagaagaccatcagtgcccaagatgtactggaagcattgtcccaggtcgattttggatgt ctgatcgaaccattacaacaactattagaagacttcaaatcgacaaaacaacaaaagaaa gataccaaaaagccgacaccaaacaaaaacacagatgatgccgatgtgattgatttggtt gacgatgatctggaattatga

DBGET integrated database retrieval system