Rhopalosiphum maidis (corn leaf aphid): 113560679 Help Entry 113560679         CDS       T06065                                  Name (RefSeq) eclosion hormone-like   KO K28249   eclosion hormone Organism rmd  Rhopalosiphum maidis (corn leaf aphid) Brite KEGG Orthology (KO) [BR:rmd00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:rmd04052]     113560679 Cytokines and neuropeptides [BR:rmd04052]  Neuropeptides   Unclassified    113560679 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Eclosion Motif Other DBs NCBI-GeneID:  113560679 NCBI-ProteinID:  XP_026822506 LinkDB All DBs Position 1:complement(14781554..14782083) Genome browser AA seq 83 aa AA seqDB search MNASTKKIVFLAAALTLIAIVGYTSADMADVGLCIRNCAQCKKMLGAYFEGPLCADACVK FKGKMIPDCENIESVAPFLNKLE NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgaacgcttcaaccaagaaaatcgtcttcctggccgccgcgctgacattgatcgcgatc gtcggttatacgtcggcggacatggcggacgtcggcttgtgcatcaggaactgcgcgcag tgcaagaagatgttgggcgcctacttcgaagggccgctgtgcgcggacgcgtgcgtcaag ttcaagggcaagatgataccggactgcgagaacatcgaatccgtggcaccgttcctcaac aagctcgagtga

DBGET integrated database retrieval system