Cupriavidus metallidurans: Rmet_2101 Help Entry Rmet_2101         CDS       T00351                                  Symbol hfq Name (GenBank) host factor I protein (Hfq)   KO K03666   host factor-I protein Organism rme  Cupriavidus metallidurans Pathway rme02024   Quorum sensing rme03018   RNA degradation Brite KEGG Orthology (KO) [BR:rme00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     Rmet_2101 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     Rmet_2101 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:rme03019]     Rmet_2101 (hfq)    03036 Chromosome and associated proteins [BR:rme03036]     Rmet_2101 (hfq) Messenger RNA biogenesis [BR:rme03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      Rmet_2101 (hfq) Chromosome and associated proteins [BR:rme03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     Rmet_2101 (hfq) SSDB OrthologParalogGFIT Motif Pfam:  Hfq LSM Hfq_1 EDC3_N SRP14 Motif Other DBs NCBI-ProteinID:  ABF08980 UniProt:  Q1LLJ6 LinkDB All DBs Position complement(2282348..2282587) Genome browser AA seq 79 aa AA seqDB search MSNKGQLLQDPFLNALRKEHVPVSIYLVNGIKLQGNIESFDQYVVLLRNTVTQMVYKHAI STVVPARAVNFRVDDSSES NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcaacaaagggcaattgctacaagacccgtttctgaatgcgctgcgcaaagagcac gtgccagtttccatctacctcgtcaatggcatcaagctgcaaggcaatatcgagtcgttc gaccagtacgtcgtcctgctgcgcaacactgtgacgcagatggtttacaagcatgcgatt tccactgtcgtgccggcgcgcgccgtcaatttccgtgtggatgattcttccgagagctga

DBGET integrated database retrieval system