KEGG   Cupriavidus metallidurans: Rmet_2180
Entry
Rmet_2180         CDS       T00351                                 
Symbol
phoB
Name
(GenBank) DNA-binding response regulator in two-component regulatory system with PhoR (or CreC)
  KO
K07657  two-component system, OmpR family, phosphate regulon response regulator PhoB
Organism
rme  Cupriavidus metallidurans
Pathway
rme02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rme00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Rmet_2180 (phoB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:rme02022]
    Rmet_2180 (phoB)
Two-component system [BR:rme02022]
 OmpR family
  PhoR-PhoB (phosphate starvation response)
   Rmet_2180 (phoB)
SSDB
Motif
Pfam: Trans_reg_C Response_reg HTH_11 VpsR
Other DBs
NCBI-ProteinID: ABF09059
UniProt: Q1LLB7
LinkDB
Position
complement(2388147..2388854)
AA seq 235 aa
MPSSILVVEDEPAIAELIAVNLQHAGHYPIRAYNAEQALSLMSDVLPDLVLLDWMLPGKS
GATFAKELRNNDRTKQIPIIMLTARSEEQDKVMGLEAGADDYVTKPFSPKELLARIKAVL
RRRAPQLTDDVVAINGLRLDPATHRVTGQDDGGPIKLDLGPTEFRLLHFLMTHPERVHSR
SQLLDQVWGDHVFVEERTVDVHIKRLRAALTPGGYSNMIETVRGSGYRLARSPSH
NT seq 708 nt   +upstreamnt  +downstreamnt
atgccaagcagtattctcgttgtcgaagacgaaccggcaatcgccgagttgattgccgtc
aatctgcagcacgccgggcactatcccatccgcgcatacaacgccgagcaggcgctgtcg
ctgatgagtgacgtgctgccggatctcgtgctgctggactggatgctcccgggcaaatcg
ggtgccaccttcgccaaggagctgcgcaacaacgatcgcaccaagcagatcccgatcatc
atgctcactgcgcgcagcgaggagcaggacaaggtgatgggcctggaagctggcgcggac
gactatgtgaccaagcctttttcgcccaaggaactgctggcccggatcaaggcggtattg
cgccgccgtgcgccgcagctgaccgacgacgtggtggcgatcaacggcctgcgtcttgac
ccggccacgcaccgcgttaccggccaggatgatggtggtccgatcaagctggatctggga
ccgacggagttccgtttgctgcacttcttgatgacgcatccggagcgtgtgcatagtcgt
tcacagttgctggatcaggtttggggcgaccacgttttcgtggaagaacggaccgtggac
gtacacatcaagcgcctgcgcgccgcgctgaccccgggtggatacagcaacatgatcgaa
accgtgcgcggcagcggctatcgcctggcgcgatcgccaagccactga

DBGET integrated database retrieval system