Cupriavidus metallidurans: Rmet_2427 Help Entry Rmet_2427         CDS       T00351                                  Symbol acpP Name (GenBank) acyl carrier protein (ACP)   KO K02078   acyl carrier protein Organism rme  Cupriavidus metallidurans Pathway rme00998   Biosynthesis of various antibiotics rme01100   Metabolic pathways rme01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rme00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Rmet_2427 (acpP)    00074 Mycolic acid biosynthesis     Rmet_2427 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Rmet_2427 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L50 DUF1896 DUF1493 MAP Motif Other DBs NCBI-ProteinID:  ABF09304 UniProt:  Q1LKM2 LinkDB All DBs Position complement(2637618..2637857) Genome browser AA seq 79 aa AA seqDB search MDNIEQRVKKIVAEQLGVAEADIKNESSFVNDLGADSLDTVELVMALEDEFGMEIPDEEA EKITTVQQAIDYATAHVKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggacaatatcgaacaacgcgtcaagaaaatcgttgctgagcagcttggcgtggccgag gcagacatcaagaacgaatcgtcgttcgtgaacgatctcggtgcggactcgctggacacg gttgaactcgtgatggcgttggaagatgaattcggcatggaaattcccgatgaggaagcc gaaaagatcacgaccgtgcaacaagctattgactacgctaccgcgcacgtcaaggcctaa

DBGET integrated database retrieval system