Cupriavidus metallidurans: Rmet_6593 Help Entry Rmet_6593         CDS       T00351                                  Name (GenBank) hypothetical protein   KO K07458   DNA mismatch endonuclease, patch repair protein [EC:3.1.-.-] Organism rme  Cupriavidus metallidurans Brite KEGG Orthology (KO) [BR:rme00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:rme03400]     Rmet_6593 DNA repair and recombination proteins [BR:rme03400]  Prokaryotic type   SSBR (single strand breaks repair)    MMR (mismatch excision repair)     Other MMR factors      Rmet_6593 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Vsr POLR3C_WHD Motif Other DBs NCBI-ProteinID:  ADC45194 UniProt:  D3DY24 LinkDB All DBs Position complement(3642149..3642418) Genome browser AA seq 89 aa AA seqDB search MAGDPNGKPGARITNVPAIREGHPQLMAITRSHATDSGQRYCSETARLLRLLWHKGYRLN RTDLPGRSDVAFIVQRKVIFVHGCFLARA NT seq 270 nt NT seq  +upstreamnt  +downstreamnt ttggcgggagaccccaacggcaagcccggcgcccgtattaccaacgtacctgctattagg gaggggcatccacagcttatggctatcacccgaagtcatgcgacggattcggggcagaga tattgctccgaaaccgcgcgactgcttcggttactctggcacaagggctatcgcctcaac cgcacagacctacctggtaggtccgacgttgcattcattgtgcagcggaaggtcatcttc gtgcatggatgttttttggcacgggcatag

DBGET integrated database retrieval system