Roseimaritima multifibrata: FF011L_46690 Help Entry FF011L_46690      CDS       T07409                                  Name (GenBank) Anti-sigma-28 factor, FlgM   KO K02398   negative regulator of flagellin synthesis FlgM Organism rml  Roseimaritima multifibrata Pathway rml02020   Two-component system rml02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:rml00001]  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     FF011L_46690  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     FF011L_46690  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:rml02035]     FF011L_46690 Bacterial motility proteins [BR:rml02035]  Flagellar system   Flagellar assembly proteins    Others     FF011L_46690 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FlgM Motif Other DBs NCBI-ProteinID:  QDS95868 UniProt:  A0A517MLU5 LinkDB All DBs Position 6016627..6016929 Genome browser AA seq 100 aa AA seqDB search MQIFGPIRVSTSQATQANNRITPPQPGQGSATRSAGPVDQLDISSAAKAAFGSAPTDAVA GGGEIRLDRVAEIRRAIADGSYDTPEKMDMAMSRMLDRFA NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atgcaaattttcggcccaattcgagtttcaaccagccaagcgactcaggccaacaatcgc attaccccccctcaaccggggcaaggtagcgctacgcggtctgctggaccggtagatcag ctggatatttcctccgccgccaaagccgcctttggttcggctcctacggatgcggtagcc ggaggaggcgaaattcgccttgaccgagtcgctgaaatccgccgggcaatcgccgacggg agctacgacactccagaaaaaatggacatggctatgagccggatgctggatcgtttcgct tga

DBGET integrated database retrieval system