Roseovarius mucosus: ROSMUCSMR3_00635 Help Entry ROSMUCSMR3_00635  CDS       T04779                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism rmm  Roseovarius mucosus Pathway rmm01100   Metabolic pathways rmm01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rmm00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ROSMUCSMR3_00635 (acpP)    00074 Mycolic acid biosynthesis     ROSMUCSMR3_00635 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ROSMUCSMR3_00635 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N DUF7080 Delta_lysin Motif Other DBs NCBI-ProteinID:  ARE82138 UniProt:  A0A1V0RK35 LinkDB All DBs Position complement(655601..655834) Genome browser AA seq 77 aa AA seqDB search MSDIADRVKKIVVEHLGVEEDKVVDKASFIDDLGADSLDTVELVMAFEEEFGIEIPDDAA DTIQTFGDAVKFITEAS NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgcagaccgcgttaagaagatcgttgtggaacacctgggtgtcgaagag gacaaggtcgtcgacaaagcctctttcatcgacgatctcggcgcggacagtctcgacacc gtcgaactggtcatggcattcgaagaagaatttggcattgagatccccgacgatgcggcg gatacaatccagacctttggcgacgcggtcaagttcatcaccgaagcgtcctga

DBGET integrated database retrieval system