Roseomonas marmotae: IAI58_06870 Help Entry IAI58_06870       CDS       T08030                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism rmt  Roseomonas marmotae Pathway rmt00998   Biosynthesis of various antibiotics rmt01100   Metabolic pathways rmt01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rmt00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     IAI58_06870    00074 Mycolic acid biosynthesis     IAI58_06870   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     IAI58_06870 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N Ribosomal_L50 DnaT_2 DUF5783 Motif Other DBs NCBI-ProteinID:  QTI80456 LinkDB All DBs Position 1451251..1451490 Genome browser AA seq 79 aa AA seqDB search MSDTADKVKKIVVEHLGVEEAKVTSEASFIDDLGADSLDTVELVMAFEEAFGVEIPDDAA EKITTVKDAIDYIEAQKAA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcgataccgccgacaaggtgaagaagatcgttgtcgagcatctcggcgtcgaagag gccaaggtgacgtctgaggcgtctttcatcgatgacctgggcgccgacagcctcgacacc gtcgagctggtgatggcgttcgaggaggccttcggggtcgagatcccggacgacgccgcc gagaagatcacgaccgtcaaggacgcgatcgactacatcgaggcgcagaaggcggcctga

DBGET integrated database retrieval system