Roseomonas mucosa: FOB66_03475 Help Entry FOB66_03475       CDS       T06208                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism rmuc  Roseomonas mucosa Brite KEGG Orthology (KO) [BR:rmuc00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:rmuc03032]     FOB66_03475    03036 Chromosome and associated proteins [BR:rmuc03036]     FOB66_03475    03400 DNA repair and recombination proteins [BR:rmuc03400]     FOB66_03475 DNA replication proteins [BR:rmuc03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     FOB66_03475 Chromosome and associated proteins [BR:rmuc03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     FOB66_03475 DNA repair and recombination proteins [BR:rmuc03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       FOB66_03475 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding Motif Other DBs NCBI-ProteinID:  QET91996 LinkDB All DBs Position 3:47485..47751 Genome browser AA seq 88 aa AA seqDB search MSKKFIADVIQQSSDLTGLASVRLAGAAIEAIKAEIIETGRFSLPEFGSFSVRETPKRTA LNPRTGEKVQVKAGATAVRVNVVVALLS NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgtcgaagaagttcatcgctgacgtgattcagcaatcctccgatctgaccggcctggcc tcggtgcgcctggcgggcgcggcgatcgaggccatcaaggccgagatcatcgagaccggc cgtttctcgctgccggagttcggctccttctcggtacgcgagaccccgaagcgcacggcg ctgaacccacgcaccggcgagaaggtccaggtcaaggccggcgcgacggcggtgcgcgtc aacgtagttgtcgccttgctatcgtaa

DBGET integrated database retrieval system