Ralstonia nicotianae: GO999_12535 Help Entry GO999_12535       CDS       T09041                                  Name (GenBank) 4-oxalocrotonate tautomerase   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism rnc  Ralstonia nicotianae Pathway rnc00362   Benzoate degradation rnc00621   Dioxin degradation rnc00622   Xylene degradation rnc01100   Metabolic pathways rnc01120   Microbial metabolism in diverse environments rnc01220   Degradation of aromatic compounds Brite KEGG Orthology (KO) [BR:rnc00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     GO999_12535    00622 Xylene degradation     GO999_12535    00621 Dioxin degradation     GO999_12535 Enzymes [BR:rnc01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      GO999_12535 SSDB OrthologParalogGFIT Motif Pfam:  Tautomerase Tautomerase_2 Motif Other DBs NCBI-ProteinID:  QUP59307 UniProt:  A0ABX7ZVA6 LinkDB All DBs Position complement(2756452..2756640) Genome browser AA seq 62 aa AA seqDB search MPTFHIEMFEGRSADQKRKLVEEVTRVTCETLGCAPGAVDIIIAEVKRENWATGGVLWSE QK NT seq 189 nt NT seq  +upstreamnt  +downstreamnt atgccgacattccacatcgagatgttcgagggccgcagcgccgaccagaagcgcaagctg gtcgaggaggtcacgcgcgtcacctgcgagaccctgggctgcgcgcccggcgcggtcgac atcatcatcgccgaggtcaagcgcgagaactgggccaccggcggcgtgctctggtccgag cagaagtaa

DBGET integrated database retrieval system