Rattus norvegicus (rat): 100361891 Help Entry 100361891         CDS       T01003                                  Symbol Rab5al1 Name (RefSeq) ras-related protein Rab-5A   KO K07887   Ras-related protein Rab-5A Organism rno  Rattus norvegicus (rat) Pathway rno04014   Ras signaling pathway rno04137   Mitophagy - animal rno04144   Endocytosis rno04145   Phagosome rno04148   Efferocytosis rno04962   Vasopressin-regulated water reabsorption rno05014   Amyotrophic lateral sclerosis rno05022   Pathways of neurodegeneration - multiple diseases rno05132   Salmonella infection rno05146   Amoebiasis rno05152   Tuberculosis Brite KEGG Orthology (KO) [BR:rno00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     100361891 (Rab5al1)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     100361891 (Rab5al1)    04145 Phagosome     100361891 (Rab5al1)    04137 Mitophagy - animal     100361891 (Rab5al1)    04148 Efferocytosis     100361891 (Rab5al1)  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     100361891 (Rab5al1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     100361891 (Rab5al1)    05152 Tuberculosis     100361891 (Rab5al1)   09174 Infectious disease: parasitic    05146 Amoebiasis     100361891 (Rab5al1)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     100361891 (Rab5al1)    05022 Pathways of neurodegeneration - multiple diseases     100361891 (Rab5al1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:rno04131]     100361891 (Rab5al1)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:rno04147]     100361891 (Rab5al1)    04031 GTP-binding proteins [BR:rno04031]     100361891 (Rab5al1) Membrane trafficking [BR:rno04131]  Endocytosis   Rab GTPases and associated proteins    Rab GTPases     100361891 (Rab5al1)  Endosome - Lysosome transport     100361891 (Rab5al1) Exosome [BR:rno04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100361891 (Rab5al1)   Exosomal proteins of other body fluids (saliva and urine)    100361891 (Rab5al1)   Exosomal proteins of colorectal cancer cells    100361891 (Rab5al1)   Exosomal proteins of bladder cancer cells    100361891 (Rab5al1) GTP-binding proteins [BR:rno04031]  Small (monomeric) G-proteins   Rab Family    Rab5/17/22/31 [OT]     100361891 (Rab5al1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 Gtr1_RagA GTP_EFTU RsgA_GTPase AAA_16 MCR_beta Motif Other DBs NCBI-GeneID:  100361891 NCBI-ProteinID:  XP_003751425 RGD:  2319287 Ensembl:  ENSRNOG00000062595 UniProt:  M0RC99 LinkDB All DBs Position 14:72544798..72546910 Genome browser AA seq 215 aa AA seqDB search MANRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQ TVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFSRAKNWVKELQR QASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTPMNVNEIFMAIAKK LPKNEPQNPGANSARGRGVDLTEPAQPARSQCCSN NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atggctaatcgaggagcaacaagacccaacgggccaaatactggaaataaaatatgccag ttcaaactggtacttctaggagagtctgctgttggcaaatcaagtctggtgcttcgcttt gtgaaaggccaatttcatgagtttcaagagagtaccattggggctgcctttctaacccaa actgtgtgtcttgatgacacaacagtaaaatttgaaatatgggatacagctggccaagaa cggtatcatagcctagcaccaatgtactaccgaggagcacaagccgccatagttgtgtat gatattacaaatgaggagtccttttcgagagcaaaaaactgggttaaagaacttcaaagg caagcgagtcctaatattgtgatagctttgtcaggaaacaaggctgacttagcaaataaa agagctgttgacttccaggaagcacagtcctatgcagatgacaacagcttattatttatg gagacatcagctaagacaccaatgaatgtaaatgaaatatttatggcaatagctaaaaag ctgccaaagaacgaaccacaaaatccaggcgcaaactcagccagaggacgaggagtagac cttactgagcctgcacagccagccagaagccagtgttgtagtaactga

DBGET integrated database retrieval system