KEGG   Rattus norvegicus (rat): 100364062
Entry
100364062         CDS       T01003                                 

Definition
(RefSeq) pyruvate kinase PKM
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00010  Glycolysis / Gluconeogenesis
rno00230  Purine metabolism
rno00620  Pyruvate metabolism
rno01100  Metabolic pathways
rno01200  Carbon metabolism
rno01230  Biosynthesis of amino acids
rno01240  Biosynthesis of cofactors
rno04922  Glucagon signaling pathway
rno04930  Type II diabetes mellitus
rno05165  Human papillomavirus infection
rno05203  Viral carcinogenesis
rno05230  Central carbon metabolism in cancer
Module
rno_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
rno_M00002  Glycolysis, core module involving three-carbon compounds
rno_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
rno_M00050  Guanine ribonucleotide biosynthesis, IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100364062
   00620 Pyruvate metabolism
    100364062
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100364062
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    100364062
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100364062
   05230 Central carbon metabolism in cancer
    100364062
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100364062
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100364062
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    100364062
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    100364062
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     100364062
Membrane trafficking [BR:rno04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    100364062
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   100364062
SSDB
Motif
Pfam: PK PK_C HpcH_HpaI IMPDH
Other DBs
NCBI-GeneID: 100364062
NCBI-ProteinID: XP_003752000
RGD: 2321795
LinkDB
Position
20
AA seq 532 aa
MPKPDSEAGTAFIQTQQLHAAMADTFLEHMCRLDIDSAPITARNTGIICTIGPASRSVEM
LKEMIKSGMNVARLNFSHGTHEYHAETIKNVRAATESFASDPILYRPVAVALDTKGPEIR
TGLIKGSGTAEVELKKGATLKITLDNAYMEKCDENILWLDYKNICKVVEVGSKIYVDDGL
ISLQVKEKGADYLVTEVENGGSLGSKKGVNLPGAAVDLPAVSEKDIQDLKFGVEQDVDMV
FASFIRKAADVHEVRKVLGEKGKNIKIISKIENHEGVRRFDEILEASDGIMVARGDLGIE
IPAEKVFLAQKMMIGRCNRAGKPVICANQMLESMIKKPRPTRAEGSDVANAVLDGADCIM
LSGVTAKGDYPLEAVRMQHLIAREAEAAIYHLQLFEELRRLAPITSDPTEAAAVGAVEAS
FKCCSGAIIVLTKSGRSAHQVARYLPRAPIIAVTRNPQTARQAHLYRGIFPVLCKDAVLD
AWAEDVDLRVNLAMNVGKARGFFKKGDVVIVLTGWRPGSGFTNTMRVVPVPR
NT seq 1599 nt   +upstreamnt  +downstreamnt
atgcccaagccagacagcgaagcagggactgccttcattcagacccagcagctccatgca
gccatggctgacaccttcctggaacacatgtgccgcctggacattgactccgcacccatc
acggcccgcaacactgggatcatctgtaccattggccctgcttcccgatctgtggagatg
ctgaaggagatgattaagtctgggatgaatgtggctcggctgaatttctctcatggaacc
catgagtaccatgcagagactatcaagaatgtccgtgcagccacagaaagctttgcatct
gatcccattctctaccgacccgttgcggtggctctggatacaaagggacctgagatccgg
actggactcatcaagggcagcggcaccgcagaggtggagctgaagaagggagccacactg
aagatcaccctggacaacgcctacatggagaagtgcgacgagaacatcctgtggctggac
tataagaacatctgcaaggtggtggaggtgggcagcaagatctacgtggacgatgggctc
atctccctgcaggtgaaggagaaaggtgctgactacctggtgacagaagtggaaaatggt
ggctccttgggcagcaagaagggcgtgaacctgcctggtgctgctgtggacctccctgct
gtgtcagaaaaggacatccaggacctgaagtttggggtggagcaggacgtggacatggtg
tttgcgtctttcatccgcaaggcggctgacgtgcatgaggttaggaaggtcctgggagag
aagggcaagaacatcaagatcatcagcaaaatcgagaaccatgaaggtgtccgcaggttt
gatgagattttggaggccagcgatggaatcatggtagctcgtggtgacctgggcattgag
attccggcagagaaggtcttcctagctcagaagatgatgattggacgatgcaaccgagct
gggaagccggtcatctgtgccaaccagatgctggagagcatgatcaagaagccacgcccc
acccgtgctgaaggcagtgacgtggccaatgcagtcctagatggagctgactgcatcatg
ctgtccggagtaacagccaaaggggactaccctctggaggctgttcgcatgcagcacctg
attgcccgagaggcagaggctgccatctaccacttgcagttattcgaggaactccgccgc
ctggcgcccattaccagcgaccccacagaagctgccgccgtgggtgccgtggaggcctcc
ttcaagtgctgcagtggggccattatcgtgctcaccaagtctggcaggagtgctcaccaa
gtggcccggtacctcccaagggctcctatcattgctgtgacacgcaatccccagacagcc
cgccaggcccatctgtaccgtggcatcttccctgtgctgtgtaaggatgccgtactggat
gcctgggctgaggacgttgatcttcgtgtgaacttggccatgaatgttggcaaggcccga
ggcttcttcaagaagggagatgtggtcattgtgctgaccggatggcgccctggctctggc
ttcaccaacaccatgcgtgtagtgcctgtaccacgatga

KEGG   Rattus norvegicus (rat): 24651
Entry
24651             CDS       T01003                                 

Gene name
Pklr
Definition
(RefSeq) pyruvate kinase PKLR
  KO
K12406  pyruvate kinase isozymes R/L [EC:2.7.1.40]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00010  Glycolysis / Gluconeogenesis
rno00230  Purine metabolism
rno00620  Pyruvate metabolism
rno01100  Metabolic pathways
rno01200  Carbon metabolism
rno01230  Biosynthesis of amino acids
rno01240  Biosynthesis of cofactors
rno04910  Insulin signaling pathway
rno04930  Type II diabetes mellitus
rno04932  Non-alcoholic fatty liver disease
rno04950  Maturity onset diabetes of the young
Module
rno_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
rno_M00002  Glycolysis, core module involving three-carbon compounds
rno_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
rno_M00050  Guanine ribonucleotide biosynthesis, IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    24651 (Pklr)
   00620 Pyruvate metabolism
    24651 (Pklr)
  09104 Nucleotide metabolism
   00230 Purine metabolism
    24651 (Pklr)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    24651 (Pklr)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    24651 (Pklr)
   04950 Maturity onset diabetes of the young
    24651 (Pklr)
   04932 Non-alcoholic fatty liver disease
    24651 (Pklr)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    24651 (Pklr)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     24651 (Pklr)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   24651 (Pklr)
SSDB
Motif
Pfam: PK PK_C IMPDH HpcH_HpaI
Other DBs
NCBI-GeneID: 24651
NCBI-ProteinID: NP_036756
RGD: 3336
Ensembl: ENSRNOG00000020420
UniProt: P12928 B1WBN9
LinkDB
Position
2
AA seq 543 aa
MEGPAGYLRRASVAQLTQELGTAFFQQQQLPAAMADTFLEHLCLLDIDSQPVAARSTSII
ATIGPASRSVDRLKEMIKAGMNIARLNFSHGSHEYHAESIANIREATESFATSPLSYRPV
AIALDTKGPEIRTGVLQGGPESEVEIVKGSQVLVTVDPKFQTRGDAKTVWVDYHNITRVV
AVGGRIYIDDGLISLVVQKIGPEGLVTEVEHGGILGSRKGVNLPNTEVDLPGLSEQDLLD
LRFGVQHNVDIIFASFVRKASDVLAVRDALGPEGQNIKIISKIENHEGVKKFDEILEVSD
GIMVARGDLGIEIPAEKVFLAQKMMIGRCNLAGKPVVCATQMLESMITKARPTRAETSDV
ANAVLDGADCIMLSGETAKGSFPVEAVMMQHAIAREAEAAVYHRQLFEELRRAAPLSRDP
TEVTAIGAVEASFKCCAAAIIVLTKTGRSAQLLSQYRPRAAVIAVTRSAQAARQVHLSRG
VFPLLYREPPEAIWADDVDRRVQFGIESGKLRGFLRVGDLVIVVTGWRPGSGYTNIMRVL
SVS
NT seq 1632 nt   +upstreamnt  +downstreamnt
atggaagggccagcgggataccttcgacgtgcgagtgtggctcaactgacccaggagctg
ggcactgccttcttccagcagcagcaactgcccgcagctatggcggacaccttcctggaa
cacctctgccttctggatatcgactcacagcctgtggctgctcgtagcaccagcatcatt
gccaccattgggccagcatcccgctctgtggaccgcctcaaggagatgatcaaagcaggg
atgaacattgcacgactcaacttctcccatggctcccatgagtaccatgcagaatccatc
gccaacatccgggaggcaactgagagttttgcaacctccccactcagctacagacctgtg
gccatcgccctggacaccaagggacctgagatacgaaccggagtcttgcaggggggtccg
gagtcggaggtggaaattgtgaagggctcacaggtgctggtgacggtggacccgaagttc
cagacaaggggcgatgcaaagacagtgtgggtggactaccacaatatcacccgggtcgtt
gcagtggggggccgcatctacattgacgacgggctcatctccttagtggtacagaaaatc
ggcccagagggactggtgacagaagtggagcacggtggtatcttgggcagcaggaagggt
gtgaacttgccaaacactgaggtggacctgcccgggctgtctgagcaagaccttttggat
ctgcgcttcggggtgcagcataatgtggacatcatctttgcctcctttgtgcggaaagcc
agtgacgtgttagcagtccgggatgccctggggccagaaggacagaacatcaaaattatc
agcaaaatcgagaaccatgaaggcgtgaagaagtttgatgaaattctagaagtgagcgat
ggcatcatggtggcacggggtgacctgggcattgagatccctgcggagaaggttttcttg
gctcagaagatgatgattggacgctgcaacctggccggcaagcctgtcgtttgtgccaca
cagatgctggagagcatgatcactaaggctcgaccaactcgggcggagacaagcgatgtg
gccaatgccgtgctggatggggctgactgtatcatgctgtccggagagaccgccaagggc
agttttcctgtggaagctgtaatgatgcaacatgcgattgcgcgggaggcagaggccgct
gtgtaccaccgccagttgtttgaggagctacgccgggcagcgccgctgagccgtgaccca
actgaggtcactgcgattggagccgtggaggcttccttcaagtgctgtgcagcagccatc
atcgtgctgacgaagactggccgttcagcccagcttctatctcaataccgacctcgggcg
gctgtcattgctgtgactcgatctgcccaggctgcccgacaggtccacctgtcccgagga
gtcttccccttgctctaccgtgagcctccagaggccatctgggcagatgatgtggatcga
agggtccaatttggcattgaaagtggaaagctccgtggtttcctccgtgtgggtgatctg
gtgattgtggtgacaggttggcggcctggctctggctataccaacatcatgcgggtgctg
agcgtatcctga

KEGG   Rattus norvegicus (rat): 25630
Entry
25630             CDS       T01003                                 

Gene name
Pkm
Definition
(RefSeq) pyruvate kinase PKM
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00010  Glycolysis / Gluconeogenesis
rno00230  Purine metabolism
rno00620  Pyruvate metabolism
rno01100  Metabolic pathways
rno01200  Carbon metabolism
rno01230  Biosynthesis of amino acids
rno01240  Biosynthesis of cofactors
rno04922  Glucagon signaling pathway
rno04930  Type II diabetes mellitus
rno05165  Human papillomavirus infection
rno05203  Viral carcinogenesis
rno05230  Central carbon metabolism in cancer
Module
rno_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
rno_M00002  Glycolysis, core module involving three-carbon compounds
rno_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
rno_M00050  Guanine ribonucleotide biosynthesis, IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    25630 (Pkm)
   00620 Pyruvate metabolism
    25630 (Pkm)
  09104 Nucleotide metabolism
   00230 Purine metabolism
    25630 (Pkm)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    25630 (Pkm)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    25630 (Pkm)
   05230 Central carbon metabolism in cancer
    25630 (Pkm)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    25630 (Pkm)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    25630 (Pkm)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    25630 (Pkm)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    25630 (Pkm)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     25630 (Pkm)
Membrane trafficking [BR:rno04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    25630 (Pkm)
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   25630 (Pkm)
SSDB
Motif
Pfam: PK PK_C HpcH_HpaI
Other DBs
NCBI-GeneID: 25630
NCBI-ProteinID: NP_445749
RGD: 3337
Ensembl: ENSRNOG00000011329
UniProt: P11980
LinkDB
Position
8
AA seq 531 aa
MPKPDSEAGTAFIQTQQLHAAMADTFLEHMCRLDIDSAPITARNTGIICTIGPASRSVEM
LKEMIKSGMNVARLNFSHGTHEYHAETIKNVRAATESFASDPILYRPVAVALDTKGPEIR
TGLIKGSGTAEVELKKGATLKITLDNAYMEKCDENILWLDYKNICKVVEVGSKIYVDDGL
ISLQVKEKGADYLVTEVENGGSLGSKKGVNLPGAAVDLPAVSEKDIQDLKFGVEQDVDMV
FASFIRKAADVHEVRKVLGEKGKNIKIISKIENHEGVRRFDEILEASDGIMVARGDLGIE
IPAEKVFLAQKMMIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIM
LSGETAKGDYPLEAVRMQHLIAREAEAAVFHRLLFEELARASSQSTDPLEAMAMGSVEAS
YKCLAAALIVLTESGRSAHQVARYRPRAPIIAVTRNPQTARQAHLYRGIFPVLCKDAVLD
AWAEDVDLRVNLAMNVGKARGFFKKGDVVIVLTGWRPGSGFTNTMRVVPVP
NT seq 1596 nt   +upstreamnt  +downstreamnt
atgcccaagccagacagcgaagcagggactgccttcattcagacccagcagctccatgca
gccatggctgacaccttcctggaacacatgtgccgcctggacattgactccgcacccatc
acggcccgcaacactgggatcatctgtaccattggccctgcttcccgatctgtggagatg
ctgaaggagatgattaagtctgggatgaatgtggctcggctgaatttctctcatggaacc
catgagtaccatgcagagactatcaagaatgtccgtgcagccacagaaagctttgcatct
gatcccattctctaccgacctgttgcggtggctctggatacaaagggacctgagatccgg
actggactcatcaagggcagcggcaccgcagaggtggagctgaagaagggagccacactg
aagatcaccctggacaacgcctacatggagaagtgcgatgagaacatcctgtggctggac
tataagaacatctgcaaggtggtggaggtgggcagcaagatctacgtggacgatgggctc
atctccctgcaggtgaaggagaaaggtgctgactacctggtgacagaagtggaaaatggt
ggctccttgggcagcaagaagggcgtgaacctgcctggtgctgctgtggacctccctgct
gtgtcagaaaaggacatccaggacctgaagtttggggtggagcaggacgtggacatggtg
tttgcgtctttcatccgcaaggcggctgacgtgcatgaggttaggaaggtcctgggagag
aagggcaagaacatcaagatcatcagcaaaatcgagaaccatgaaggtgtccgcaggttt
gatgagattttggaggccagcgatggaatcatggtagctcgtggtgacctgggcattgag
attccggcagagaaggtcttcctagctcagaagatgatgattggacgatgcaaccgagct
gggaagccagtcatctgcgccacccagatgctggagagcatgatcaagaagccacgcccc
acccgtgctgaaggcagtgacgtggccaatgcagtcctagatggagctgactgcatcatg
ctgtccggagaaacagccaaaggggactaccctctggaggctgttcgcatgcagcacctg
atagctcgagaggctgaggcagccgtgttccaccgcctgctgtttgaagagcttgcgcga
gcctccagtcaatccacagaccccctggaggccatggccatgggcagcgtggaggcctct
tataaatgtttagcagcagctttgatagttctgacggagtccggcaggagtgctcaccaa
gtggcccggtaccgcccaagggctcctatcattgctgtgacacgcaatccccagacagcc
cgccaggcccatctgtaccgtggcatcttccctgtgctgtgtaaggatgccgtactggat
gcctgggctgaggacgttgatcttcgtgtgaacttggccatgaatgttggcaaggcccga
ggcttcttcaagaagggagatgtggtcattgtgctgactggatggcgccctggctctggc
ttcaccaacaccatgcgtgtagtgcctgtaccatga

DBGET integrated database retrieval system