Rattus norvegicus (rat): 100910200 Help Entry 100910200         CDS       T01003                                  Symbol H2bcl1 Name (RefSeq) histone H2B type 1-C/E/G-like   KO K11252   histone H2B Organism rno  Rattus norvegicus (rat) Pathway rno04613   Neutrophil extracellular trap formation rno05034   Alcoholism rno05203   Viral carcinogenesis rno05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:rno00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     100910200 (H2bcl1)  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     100910200 (H2bcl1)   09163 Immune disease    05322 Systemic lupus erythematosus     100910200 (H2bcl1)   09165 Substance dependence    05034 Alcoholism     100910200 (H2bcl1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:rno03036]     100910200 (H2bcl1)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:rno04147]     100910200 (H2bcl1) Chromosome and associated proteins [BR:rno03036]  Eukaryotic type   Nucleosome assembly factors    Histones     100910200 (H2bcl1) Exosome [BR:rno04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100910200 (H2bcl1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa Motif Other DBs NCBI-GeneID:  100910200 NCBI-ProteinID:  NP_001396017 RGD:  6499934 LinkDB All DBs Position 17:complement(47448213..47448683) Genome browser AA seq 126 aa AA seqDB search MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSSK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcctgagcccgcgaagtccgctcccgccccgaagaagggctccaagaaggccgtgacc aaggcgcagaagaaggacggcaagaagcgcaagcgcagccgcaaggagagctactcggtg tacgtgtacaaggtgctgaagcaagtgcacccggacacgggcatctcttctaaggccatg ggcatcatgaactcgttcgtgaacgacatcttcgagcgcatcgcgggcgaggcgtcgcgt ctagcgcattacaacaagcgctcgaccatcacgtcccgggagatccagacggccgtgcgc ctgctgctgcccggggagctggccaagcacgctgtgtccgagggcaccaaggcggtcacc aagtacaccagctccaagtga

DBGET integrated database retrieval system