Rattus norvegicus (rat): 100911464 Help Entry 100911464         CDS       T01003                                  Name (RefSeq) glutathione S-transferase P-like   KO K23790   glutathione S-transferase P [EC:2.5.1.18] Organism rno  Rattus norvegicus (rat) Pathway rno00480   Glutathione metabolism rno00980   Metabolism of xenobiotics by cytochrome P450 rno00982   Drug metabolism - cytochrome P450 rno00983   Drug metabolism - other enzymes rno01100   Metabolic pathways rno01524   Platinum drug resistance rno05200   Pathways in cancer rno05204   Chemical carcinogenesis - DNA adducts rno05215   Prostate cancer rno05225   Hepatocellular carcinoma rno05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:rno00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     100911464   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     100911464    00982 Drug metabolism - cytochrome P450     100911464    00983 Drug metabolism - other enzymes     100911464  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100911464    05204 Chemical carcinogenesis - DNA adducts     100911464   09162 Cancer: specific types    05225 Hepatocellular carcinoma     100911464    05215 Prostate cancer     100911464   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     100911464   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     100911464  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:rno02000]     100911464 Enzymes [BR:rno01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      100911464 Transporters [BR:rno02000]  Other transporters   Pores ion channels [TC:1]    100911464 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  GST_C_3 GST_C GST_N GST_C_7 Motif Other DBs NCBI-GeneID:  100911464 NCBI-ProteinID:  XP_038967329 RGD:  6492721 LinkDB All DBs Position 5:43383287..43388827 Genome browser AA seq 249 aa AA seqDB search MGHDGQPPDCPQGMKAITKPHPLQGGKDNGARTACSTAGGDPMPETARMEFSLKHALWKL LETAGIISQDVETTVALFKGLFRFEVVQGWSGKLHTCLYGQLPKFEDGDLTLYQSSAILR HVGHSFGLYGKGQREAALVDMVNDGVEDLHYRYVTLIYTIYENGKDDYMKALPGHLKPFE TLLSQNQEGKAFIVGDQISFANYNLLDLLLVHFPLLAAYVVHLSAQPKIKAFLSSSNDVN RPINDKGKQ NT seq 750 nt NT seq  +upstreamnt  +downstreamnt atgggtcatgacggtcagcccccggactgtcctcagggcatgaaagctataaccaagcca caccctcttcaaggagggaaggataatggagcaagaactgcatgcagcactgcaggagga gacccgatgccagaaactgctcgaatggaattttcactaaagcatgccctttggaaactt ctagaaacagctgggattatttcccaagatgtagaaacaacagtggctttgtttaaaggt ttgttcaggtttgaagtggttcagggatggtcgggaaaattgcacacttgtctgtatggg cagcttcccaagtttgaggatggagacctcaccctttaccaatctagtgccatcctgagg cacgtgggccactcttttggactttatgggaaaggccagagggaagccgccctggtggat atggtgaatgatggggtggaggaccttcactacagatatgtcaccctcatctacaccatc tatgagaatggtaaggacgactatatgaaggccctgcctgggcatctgaagccttttgag accctgttgtcccagaaccaggaaggtaaagctttcatcgtgggtgatcagatttccttt gccaattacaacttgctggacctgctgctggtccacttccccctgctcgctgcctatgtg gttcacctcagtgcccagcccaagatcaaagcctttctgtcctcctctaacgatgtgaac cgtcccatcaatgacaagggcaaacagtag

DBGET integrated database retrieval system