Rattus norvegicus (rat): 100912314 Help Entry 100912314         CDS       T01003                                  Name (RefSeq) interferon alpha-1-like   KO K05414   interferon alpha Organism rno  Rattus norvegicus (rat) Pathway rno04060   Cytokine-cytokine receptor interaction rno04151   PI3K-Akt signaling pathway rno04217   Necroptosis rno04620   Toll-like receptor signaling pathway rno04621   NOD-like receptor signaling pathway rno04622   RIG-I-like receptor signaling pathway rno04623   Cytosolic DNA-sensing pathway rno04630   JAK-STAT signaling pathway rno04650   Natural killer cell mediated cytotoxicity rno04936   Alcoholic liver disease rno05152   Tuberculosis rno05160   Hepatitis C rno05161   Hepatitis B rno05162   Measles rno05163   Human cytomegalovirus infection rno05164   Influenza A rno05165   Human papillomavirus infection rno05167   Kaposi sarcoma-associated herpesvirus infection rno05168   Herpes simplex virus 1 infection rno05169   Epstein-Barr virus infection rno05170   Human immunodeficiency virus 1 infection rno05171   Coronavirus disease - COVID-19 rno05200   Pathways in cancer rno05320   Autoimmune thyroid disease rno05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:rno00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     100912314    04151 PI3K-Akt signaling pathway     100912314   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100912314  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     100912314  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100912314    04621 NOD-like receptor signaling pathway     100912314    04622 RIG-I-like receptor signaling pathway     100912314    04623 Cytosolic DNA-sensing pathway     100912314    04650 Natural killer cell mediated cytotoxicity     100912314  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100912314   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100912314    05161 Hepatitis B     100912314    05160 Hepatitis C     100912314    05171 Coronavirus disease - COVID-19     100912314    05164 Influenza A     100912314    05162 Measles     100912314    05168 Herpes simplex virus 1 infection     100912314    05163 Human cytomegalovirus infection     100912314    05167 Kaposi sarcoma-associated herpesvirus infection     100912314    05169 Epstein-Barr virus infection     100912314    05165 Human papillomavirus infection     100912314   09171 Infectious disease: bacterial    05152 Tuberculosis     100912314   09163 Immune disease    05320 Autoimmune thyroid disease     100912314   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100912314   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     100912314  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:rno04052]     100912314 Cytokines and neuropeptides [BR:rno04052]  Cytokines   Interferons    100912314 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon PSD13_N Motif Other DBs NCBI-GeneID:  100912314 NCBI-ProteinID:  XP_063144647 RGD:  6487699 LinkDB All DBs Position 5:complement(108391833..108411017) Genome browser AA seq 191 aa AA seqDB search MARLCAFLMILIVMSYCRSTCCLGCDLPHTHNLRNKRAFTLLAQMRRLSPVSCLKDRQDF GFPLEKVDGQQIQKAQAIPVLHELTQQILSLFTSKESSTAWDATLLDSFCNDLQQQLSGL QACQMQQVGVQESHLAQEDSLLAVREYFHRITVYLREKKHSPCAWEVVRAEVWRALSSSA NLLARLREEKK NT seq 576 nt NT seq  +upstreamnt  +downstreamnt atggctaggctttgtgctttcctgatgatcctgatcgtgatgagctattgtagatcaacc tgctgtctaggatgtgacctgcctcatactcataacctcaggaacaagagagcattcaca ctcctggcacaaatgaggagactctcccctgtctcctgcctgaaggacagacaggacttt ggattccccttggagaaggtggatggccagcagatccagaaggctcaagctatccctgtc ctgcatgagctgacccagcagatcctcagcctcttcacatcaaaggagtcatctactgct tgggatgcaaccctcctagactcattctgcaatgacctccagcagcagctgagtggtctg caagcctgtcagatgcagcaagtgggggtgcaggaatctcacctggcccaggaagactcc ctattggctgtgcgggaatacttccacaggatcactgtgtacctgagagagaagaaacac agcccctgtgcctgggaggtggtcagagcagaagtctggagagctctgtcttcttcagcc aacttgctggcaagactaagagaagagaagaaatga

DBGET integrated database retrieval system