Rattus norvegicus (rat): 102551431 Help Entry 102551431         CDS       T01003                                  Name (RefSeq) profilin-2-like   KO K05759   profilin Organism rno  Rattus norvegicus (rat) Pathway rno04015   Rap1 signaling pathway rno04810   Regulation of actin cytoskeleton rno05014   Amyotrophic lateral sclerosis rno05132   Salmonella infection Brite KEGG Orthology (KO) [BR:rno00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     102551431  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     102551431  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102551431   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     102551431  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:rno04131]     102551431   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:rno04812]     102551431    04147 Exosome [BR:rno04147]     102551431 Membrane trafficking [BR:rno04131]  Others   Actin-binding proteins    Others     102551431 Cytoskeleton proteins [BR:rno04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      102551431 Exosome [BR:rno04147]  Exosomal proteins   Proteins found in most exosomes    102551431 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  102551431 NCBI-ProteinID:  XP_006257170 RGD:  7509912 Ensembl:  ENSRNOG00000066828 LinkDB All DBs Position X:64487973..64488365 Genome browser AA seq 130 aa AA seqDB search MCSDAAVIANCPPWLLASSTEGNFIQMTQEEVQTLLTREGREKLFLQGVTLAGIKCLLIR DNLFTHGNNSMDLRTKGQSRGSQAVTVVQMESVYLVVMGKKGTEGGPLNLKAFEIAGYMR EAILQKMAHC NT seq 393 nt NT seq  +upstreamnt  +downstreamnt atgtgcagtgatgcagcagttattgccaattgtccaccctggttattagcttcttctact gaagggaactttattcagatgacccaggaagaagttcagaccttgctgacaagagagggt agagaaaagctgtttctccagggagtcacccttgctggaatcaaatgcctgttgatccga gacaacttgttcacccatggcaataacagcatggacctccgtaccaaaggccaaagtcga ggtagccaggcagtgactgtagttcagatggagtctgtgtatcttgtggtgatgggaaag aaggggacagaaggaggacctctcaacctcaaagcttttgagatagcaggctacatgaga gaggccattcttcaaaaaatggctcattgctaa

DBGET integrated database retrieval system